Gene/Proteome Database (LMPD)
LMPD ID
LMP007672
Gene ID
Species
Escherichia coli K-12 (E. coli)
Gene Name
d-Galf:alpha-d-Glc beta-1,6-galactofuranosyltransferase
Gene Symbol
Synonyms
ECK2028; JW2019; yefG
Summary
WbbI is a -1,6-galactofuranosyltransferase that uses UDP-galactofuranose as the donor and has a modest preference for pyranoside acceptor substrates of the -D-gluco configuration . [More information is available at EcoCyc: EG11983].
Orthologs
Proteins
d-Galf:alpha-d-Glc beta-1,6-galactofuranosyltransferase [Escherichia coli str. K-12 substr. MG1655] | |
---|---|
Refseq ID | NP_416538 |
Protein GI | 16129974 |
UniProt ID | P37749 |
Length | 330 |
RefSeq Status | REVIEWED |
MYFLNDLNFSRRDAGFKARKDALDIASDYENISVVNIPLWGGVVQRIISSVKLSTFLCGLENKDVLIFNFPMAKPFWHILSFFHRLLKFRIVPLIHDIDELRGGGGSDSVRLATCDMVISHNPQMTKYLSKYMSQDKIKDIKIFDYLVSSDVEHRDVTDKQRGVIYAGNLSRHKCSFIYTEGCDFTLFGVNYENKDNPKYLGSFDAQSPEKINLPGMQFGLIWDGDSVETCSGAFGDYLKFNNPHKTSLYLSMELPVFIWDKAALADFIVDNRIGYAVGSIKEMQEIVDSMTIETYKQISENTKIISQKIRTGSYFRDVLEEVIDDLKTR |
Gene Information
Entrez Gene ID
Gene Name
d-Galf:alpha-d-Glc beta-1,6-galactofuranosyltransferase
Gene Symbol
Species
Escherichia coli K-12
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005737 | IEA:UniProtKB-KW | C | cytoplasm |
GO:0008921 | IDA:EcoCyc | F | lipopolysaccharide-1,6-galactosyltransferase activity |
GO:0009103 | IEA:UniProtKB-UniPathway | P | lipopolysaccharide biosynthetic process |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR016503 | UDP-Galfuran_transf |
UniProt Annotations
Entry Information
Gene Name
d-Galf:alpha-d-Glc beta-1,6-galactofuranosyltransferase
Protein Entry
WBBI_ECOLI
UniProt ID
Species
E. coli
Comments
Comment Type | Description |
---|---|
Function | Involved in the transfer of galactofuranose (Galf) onto an alpha-D-gluco-configured acceptor substrate to form a beta-1,6- linkage. It uses n-octyl alpha-D-glucopyranoside as an acceptor substrate for the addition of galactofuranose from the donor substrate UDP-galactofuranose. It is not able to use beta-D- glucopyranoside isomers. {ECO:0000269|PubMed:17047874}. |
Pathway | Bacterial outer membrane biogenesis; lipopolysaccharide biosynthesis. |
Subcellular Location | Cytoplasm {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007672 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
16129974 | RefSeq | NP_416538 | 330 | d-Galf:alpha-d-Glc beta-1,6-galactofuranosyltransferase [Escherichia coli str. K-12 substr. MG1655] |
Identical Sequences to LMP007672 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:16129974 | EMBL | CEE08345.1 | 330 | putative glycosyltransferase [Escherichia coli] |
GI:16129974 | EMBL | CDY59319.1 | 330 | beta-1,6-galactofuranosyltransferase [Escherichia coli] |
GI:16129974 | EMBL | CDZ20855.1 | 330 | beta-1,6-galactofuranosyltransferase [Escherichia coli] |
GI:16129974 | GenBank | KGA85579.1 | 330 | beta-1,6-galactofuranosyltransferase [Escherichia coli] |
GI:16129974 | gnl | PRJNA257976 | 330 | d-Galf:alpha-d-Glc beta-1,6-galactofuranosyltransferase [Escherichia coli BW25113] |
GI:16129974 | gnl | IGS | 330 | d-Galf:alpha-d-Glc beta-1,6-galactofuranosyltransferase [Escherichia coli ER2796] |
Related Sequences to LMP007672 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:16129974 | GenBank | EGU24932.1 | 332 | beta-1,6-galactofuranosyltransferase [Escherichia coli XH140A] |
GI:16129974 | GenBank | EGV46615.1 | 332 | beta-1,6-galactofuranosyltransferase [Escherichia coli XH001] |
GI:16129974 | GenBank | EMD10723.1 | 332 | beta-1,6-galactofuranosyltransferase [Escherichia coli S17] |
GI:16129974 | GenBank | ESC98097.1 | 332 | hypothetical protein HMPREF1594_01957 [Escherichia coli 907446] |
GI:16129974 | GenBank | KGL67752.1 | 332 | beta-1,6-galactofuranosyltransferase [Escherichia coli NCTC 50110] |
GI:16129974 | RefSeq | WP_033560077.1 | 330 | beta-1,6-galactofuranosyltransferase [Escherichia coli] |