Gene/Proteome Database (LMPD)

LMPD ID
LMP007672
Gene ID
Species
Escherichia coli K-12 (E. coli)
Gene Name
d-Galf:alpha-d-Glc beta-1,6-galactofuranosyltransferase
Gene Symbol
Synonyms
ECK2028; JW2019; yefG
Summary
WbbI is a -1,6-galactofuranosyltransferase that uses UDP-galactofuranose as the donor and has a modest preference for pyranoside acceptor substrates of the -D-gluco configuration . [More information is available at EcoCyc: EG11983].
Orthologs

Proteins

d-Galf:alpha-d-Glc beta-1,6-galactofuranosyltransferase [Escherichia coli str. K-12 substr. MG1655]
Refseq ID NP_416538
Protein GI 16129974
UniProt ID P37749
Length 330
RefSeq Status REVIEWED
MYFLNDLNFSRRDAGFKARKDALDIASDYENISVVNIPLWGGVVQRIISSVKLSTFLCGLENKDVLIFNFPMAKPFWHILSFFHRLLKFRIVPLIHDIDELRGGGGSDSVRLATCDMVISHNPQMTKYLSKYMSQDKIKDIKIFDYLVSSDVEHRDVTDKQRGVIYAGNLSRHKCSFIYTEGCDFTLFGVNYENKDNPKYLGSFDAQSPEKINLPGMQFGLIWDGDSVETCSGAFGDYLKFNNPHKTSLYLSMELPVFIWDKAALADFIVDNRIGYAVGSIKEMQEIVDSMTIETYKQISENTKIISQKIRTGSYFRDVLEEVIDDLKTR

Gene Information

Entrez Gene ID
Gene Name
d-Galf:alpha-d-Glc beta-1,6-galactofuranosyltransferase
Gene Symbol
Species
Escherichia coli K-12

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IEA:UniProtKB-KW C cytoplasm
GO:0008921 IDA:EcoCyc F lipopolysaccharide-1,6-galactosyltransferase activity
GO:0009103 IEA:UniProtKB-UniPathway P lipopolysaccharide biosynthetic process

Domain Information

InterPro Annotations

Accession Description
IPR016503 UDP-Galfuran_transf

UniProt Annotations

Entry Information

Gene Name
d-Galf:alpha-d-Glc beta-1,6-galactofuranosyltransferase
Protein Entry
WBBI_ECOLI
UniProt ID
Species
E. coli

Comments

Comment Type Description
Function Involved in the transfer of galactofuranose (Galf) onto an alpha-D-gluco-configured acceptor substrate to form a beta-1,6- linkage. It uses n-octyl alpha-D-glucopyranoside as an acceptor substrate for the addition of galactofuranose from the donor substrate UDP-galactofuranose. It is not able to use beta-D- glucopyranoside isomers. {ECO:0000269|PubMed:17047874}.
Pathway Bacterial outer membrane biogenesis; lipopolysaccharide biosynthesis.
Subcellular Location Cytoplasm {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007672 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
16129974 RefSeq NP_416538 330 d-Galf:alpha-d-Glc beta-1,6-galactofuranosyltransferase [Escherichia coli str. K-12 substr. MG1655]

Identical Sequences to LMP007672 proteins

Reference Database Accession Length Protein Name
GI:16129974 EMBL CEE08345.1 330 putative glycosyltransferase [Escherichia coli]
GI:16129974 EMBL CDY59319.1 330 beta-1,6-galactofuranosyltransferase [Escherichia coli]
GI:16129974 EMBL CDZ20855.1 330 beta-1,6-galactofuranosyltransferase [Escherichia coli]
GI:16129974 GenBank KGA85579.1 330 beta-1,6-galactofuranosyltransferase [Escherichia coli]
GI:16129974 gnl PRJNA257976 330 d-Galf:alpha-d-Glc beta-1,6-galactofuranosyltransferase [Escherichia coli BW25113]
GI:16129974 gnl IGS 330 d-Galf:alpha-d-Glc beta-1,6-galactofuranosyltransferase [Escherichia coli ER2796]

Related Sequences to LMP007672 proteins

Reference Database Accession Length Protein Name
GI:16129974 GenBank EGU24932.1 332 beta-1,6-galactofuranosyltransferase [Escherichia coli XH140A]
GI:16129974 GenBank EGV46615.1 332 beta-1,6-galactofuranosyltransferase [Escherichia coli XH001]
GI:16129974 GenBank EMD10723.1 332 beta-1,6-galactofuranosyltransferase [Escherichia coli S17]
GI:16129974 GenBank ESC98097.1 332 hypothetical protein HMPREF1594_01957 [Escherichia coli 907446]
GI:16129974 GenBank KGL67752.1 332 beta-1,6-galactofuranosyltransferase [Escherichia coli NCTC 50110]
GI:16129974 RefSeq WP_033560077.1 330 beta-1,6-galactofuranosyltransferase [Escherichia coli]