Gene/Proteome Database (LMPD)

LMPD ID
LMP007674
Gene ID
946559
Species
Escherichia coli K-12 (E. coli)
Gene Name
GDP-mannose mannosyl hydrolase
Gene Symbol
wcaH
Synonyms
ECK2045; JW5335; gmm; nudD; yefC
Summary
Nudix hydrolase. [More information is available at EcoGene: EG11789]. GDP-mannose mannosyl hydrolase (GDPMH) is able to hydrolyze both GDP-mannose and GDP-glucose. [More information is available at EcoCyc: EG11789].
Orthologs
View orthologs and multiple alignments for wcaH

Proteins

GDP-mannose mannosyl hydrolase [Escherichia coli str. K-12 substr. MG1655]
Refseq ID NP_416555
Protein GI 90111376
UniProt ID P32056
Length 159
RefSeq Status REVIEWED
MFLRQEDFATVVRSTPLVSLDFIVENSRGEFLLGKRTNRPAQGYWFVPGGRVQKDETLEAAFERLTMAELGLRLPITAGQFYGVWQHFYDDNFSGTDFTTHYVVLGFRFRVSEEELLLPDEQHDDYRWLTSDALLASDNVHANSRAYFLAEKRTGVPGL

Gene Information

Entrez Gene ID
946559
Gene Name
GDP-mannose mannosyl hydrolase
Gene Symbol
wcaH
Species
Escherichia coli K-12

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0047917 IDA:EcoCyc F GDP-glucosidase activity
GO:0008727 IEA:UniProtKB-HAMAP F GDP-mannose mannosyl hydrolase activity
GO:0000287 IMP:EcoCyc F magnesium ion binding
GO:0030145 IMP:EcoCyc F manganese ion binding
GO:0009103 IEA:UniProtKB-KW P lipopolysaccharide biosynthetic process

Domain Information

InterPro Annotations

Accession Description
IPR028613 GDPMH_Gmm
IPR000086 NUDIX hydrolase domain
IPR015797 NUDIX hydrolase domain-like
IPR020084 NUDIX hydrolase, conserved site

UniProt Annotations

Entry Information

Gene Name
GDP-mannose mannosyl hydrolase
Protein Entry
GMM_ECOLI
UniProt ID
P32056
Species
E. coli

Comments

Comment Type Description
Biophysicochemical Properties Kinetic parameters: KM=0.3 mM for GDP-mannose {ECO:0000269|PubMed:7592609}; KM=1.9 mM for GDP-glucose {ECO:0000269|PubMed:7592609}; Vmax=1.6 umol/min/mg enzyme with GDP-mannose as substrate {ECO:0000269|PubMed:7592609}; Vmax=7.5 umol/min/mg enzyme with GDP-glucose as substrate {ECO:0000269|PubMed:7592609}; Note=GDP-alpha-D-mannose is likely to be the biological substrate, but the Kcat/KM obtained with GDP-alpha-D-glucose is very similar to that with GDP-alpha-D-mannose.; pH dependence: Optimum pH is 9.3. {ECO:0000269|PubMed:7592609};
Catalytic Activity GDP-D-mannose + H(2)O = GDP + D-mannose. {ECO:0000255|HAMAP-Rule:MF_00941, ECO:0000269|PubMed:10913267, ECO:0000269|PubMed:7592609}.
Cofactor Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence={ECO:0000255|HAMAP-Rule:MF_00941, ECO:0000269|PubMed:10913267, ECO:0000269|PubMed:12196023, ECO:0000269|PubMed:15274914}; Note=Binds 1 Mg(2+) ion per subunit. {ECO:0000255|HAMAP- Rule:MF_00941, ECO:0000269|PubMed:10913267, ECO:0000269|PubMed:12196023, ECO:0000269|PubMed:15274914};
Function Hydrolyzes both GDP-mannose and GDP-glucose. Could participate in the regulation of cell wall biosynthesis by influencing the concentration of GDP-mannose or GDP-glucose in the cell. Might also be involved in the biosynthesis of the slime polysaccharide colanic acid. {ECO:0000269|PubMed:10913267, ECO:0000269|PubMed:7592609}.
Mass Spectrometry Mass=18472; Mass_error=67; Method=MALDI; Range=1-159; Evidence={ECO:0000269|PubMed:10913267};
Sequence Caution Sequence=AAC77844.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence={ECO:0000305};
Similarity Belongs to the Nudix hydrolase family. {ECO:0000255|HAMAP-Rule:MF_00941}.
Similarity Contains 1 nudix hydrolase domain. {ECO:0000255|HAMAP- Rule:MF_00941}.
Subunit Homodimer. {ECO:0000255|HAMAP-Rule:MF_00941, ECO:0000269|PubMed:10913267, ECO:0000269|PubMed:15274914, ECO:0000269|PubMed:16981689}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007674 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
90111376 RefSeq NP_416555 159 GDP-mannose mannosyl hydrolase [Escherichia coli str. K-12 substr. MG1655]

Identical Sequences to LMP007674 proteins

Reference Database Accession Length Protein Name
GI:90111376 EMBL CDY59364.1 159 GDP-mannose mannosyl hydrolase [Escherichia coli]
GI:90111376 EMBL CDZ20872.1 159 GDP-mannose mannosyl hydrolase [Escherichia coli]
GI:90111376 GenBank KGA85595.1 159 GDP-mannose mannosyl hydrolase [Escherichia coli]
GI:90111376 GenBank KGL68981.1 159 GDP-mannose mannosyl hydrolase NudD [Escherichia coli NCTC 50110]
GI:90111376 GenBank KHH15722.1 159 GDP-mannose mannosyl hydrolase [Escherichia coli]
GI:90111376 gnl IGS 159 GDP-mannose mannosyl hydrolase [Escherichia coli ER2796]

Related Sequences to LMP007674 proteins

Reference Database Accession Length Protein Name
GI:90111376 gnl jgi 160 NUDIX hydrolase [Escherichia coli DH1]
GI:90111376 PDB 2GT2 160 Chain A, Structure Of The E. Coli Gdp-Mannose Mannosyl Hydrolase
GI:90111376 PDB 2GT2 160 Chain B, Structure Of The E. Coli Gdp-Mannose Mannosyl Hydrolase
GI:90111376 PDB 2GT2 160 Chain C, Structure Of The E. Coli Gdp-Mannose Mannosyl Hydrolase
GI:90111376 PDB 2GT2 160 Chain D, Structure Of The E. Coli Gdp-Mannose Mannosyl Hydrolase
GI:90111376 RefSeq YP_006091560.1 160 NUDIX hydrolase [Escherichia coli DH1]