Gene/Proteome Database (LMPD)

LMPD ID
LMP007686
Gene ID
947729
Species
Escherichia coli K-12 (E. coli)
Gene Name
ABC transporter maintaining OM lipid asymmetry, ATP-binding protein
Gene Symbol
mlaF
Synonyms
ECK3184; JW3162; vpsA; yrbF
Summary
YrbF is the ATP-binding component of a predicted ABC superfamily toluene efflux transporter. [More information is available at EcoCyc: EG12801].
Orthologs
View orthologs and multiple alignments for mlaF

Proteins

ABC transporter maintaining OM lipid asymmetry, ATP-binding protein [Escherichia coli str. K-12 substr. MG1655]
Refseq ID NP_417662
Protein GI 16131085
UniProt ID P63386
Length 269
RefSeq Status REVIEWED
MEQSVANLVDMRDVSFTRGNRCIFDNISLTVPRGKITAIMGPSGIGKTTLLRLIGGQIAPDHGEILFDGENIPAMSRSRLYTVRKRMSMLFQSGALFTDMNVFDNVAYPLREHTQLPAPLLHSTVMMKLEAVGLRGAAKLMPSELSGGMARRAALARAIALEPDLIMFDEPFVGQDPITMGVLVKLISELNSALGVTCVVVSHDVPEVLSIADHAWILADKKIVAHGSAQALQANPDPRVRQFLDGIADGPVPFRYPAGDYHADLLPGS

Gene Information

Entrez Gene ID
947729
Gene Name
ABC transporter maintaining OM lipid asymmetry, ATP-binding protein
Gene Symbol
mlaF
Species
Escherichia coli K-12

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0043190 IMP:EcoCyc C ATP-binding cassette (ABC) transporter complex
GO:0005524 IEA:UniProtKB-KW F ATP binding
GO:0016887 IEA:InterPro F ATPase activity
GO:0005548 IMP:EcoCyc F phospholipid transporter activity
GO:0015914 IMP:EcoCyc P phospholipid transport

KEGG Pathway Links

KEGG Pathway ID Description
eco02010 ABC transporters
ko02010 ABC transporters
M00210 Phospholipid transport system
eco_M00210 Phospholipid transport system

Domain Information

InterPro Annotations

Accession Description
IPR003593 AAA+ ATPase domain
IPR017871 ABC transporter, conserved site
IPR003439 ABC_transporter-like
IPR027417 P-loop containing nucleoside triphosphate hydrolase

UniProt Annotations

Entry Information

Gene Name
ABC transporter maintaining OM lipid asymmetry, ATP-binding protein
Protein Entry
MLAF_ECOLI
UniProt ID
P63386
Species
E. coli

Comments

Comment Type Description
Disruption Phenotype Mutation confers sensitivity to SDS-EDTA and leads to accumulation of phospholipid in the outer leaflet of the outer membrane. {ECO:0000269|PubMed:19383799}.
Function Part of the ABC transporter complex MlaFEDB that actively prevents phospholipid accumulation at the cell surface. Probably maintains lipid asymmetry in the outer membrane by retrograde trafficking of phospholipids from the outer membrane to the inner membrane. Probably responsible for energy coupling to the transport system. {ECO:0000269|PubMed:19383799}.
Interaction P0A6F5:groL; NbExp=3; IntAct=EBI-561408, EBI-543750;
Similarity Belongs to the ABC transporter superfamily. MlaF family. {ECO:0000305}.
Similarity Contains 1 ABC transporter domain. {ECO:0000255|PROSITE-ProRule:PRU00434}.
Subcellular Location Cell inner membrane {ECO:0000305|PubMed:19383799}; Peripheral membrane protein {ECO:0000305|PubMed:19383799}; Cytoplasmic side {ECO:0000305|PubMed:19383799}.
Subunit The complex is composed of two ATP-binding proteins (MlaF), two transmembrane proteins (MlaE), two cytoplasmic solute- binding proteins (MlaB) and a periplamic solute-binding protein (MlaD). {ECO:0000305|PubMed:19383799}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007686 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
16131085 RefSeq NP_417662 269 ABC transporter maintaining OM lipid asymmetry, ATP-binding protein [Escherichia coli str. K-12 substr. MG1655]

Identical Sequences to LMP007686 proteins

Reference Database Accession Length Protein Name
GI:16131085 GenBank KHJ00162.1 269 ABC transporter ATP-binding protein [Escherichia coli]
GI:16131085 GenBank KHJ07264.1 269 ABC transporter ATP-binding protein [Escherichia coli]
GI:16131085 GenBank KHJ13772.1 269 ABC transporter ATP-binding protein [Escherichia coli]
GI:16131085 GenBank KHJ16503.1 269 ABC transporter ATP-binding protein [Escherichia coli]
GI:16131085 GenBank KHJ25761.1 269 ABC transporter ATP-binding protein [Escherichia coli]
GI:16131085 gnl IGS 269 ABC transporter maintaining OM lipid asymmetry, ATP-binding protein [Escherichia coli ER2796]

Related Sequences to LMP007686 proteins

Reference Database Accession Length Protein Name
GI:16131085 EMBL CAS11022.1 269 predicted toluene transporter subunit: ATP-binding component of ABC superfamily [Escherichia coli O127:H6 str. E2348/69]
GI:16131085 GenBank EFR14595.1 269 ABC transporter family protein [Escherichia coli 2362-75]
GI:16131085 GenBank EFZ74468.1 269 ABC transporter family protein [Escherichia coli RN587/1]
GI:16131085 GenBank EHU05931.1 269 mlaF [Escherichia coli DEC1A]
GI:16131085 GenBank EII86568.1 269 ABC transporter, ATP-binding protein [Escherichia coli 3003]
GI:16131085 RefSeq YP_002330942.1 269 ABC transporter ATP-binding protein [Escherichia coli O127:H6 str. E2348/69]