Gene/Proteome Database (LMPD)

LMPD ID
LMP007695
Gene ID
946165
Species
Escherichia coli K-12 (E. coli)
Gene Name
putative phosphate acyltransferase
Gene Symbol
plsX
Synonyms
ECK1076; JW5156
Summary
PlsX is homologous to the S. pneumoniae phosphate:acyl-ACP acyltransferase PlsX (UniProtKB: [More information is available at EcoGene: EG11437]. A mutation in plsX is required for the sn-glycerol-3-phosphate auxotrophic phenotype of a plsB mutant strain . [More information is available at EcoCyc: EG11437].
Orthologs
View orthologs and multiple alignments for plsX

Proteins

putative phosphate acyltransferase [Escherichia coli str. K-12 substr. MG1655]
Refseq ID NP_415608
Protein GI 90111212
UniProt ID P27247
Length 356
RefSeq Status REVIEWED
MTRLTLALDVMGGDFGPSVTVPAALQALNSNSQLTLLLVGNSDAITPLLAKADFEQRSRLQIIPAQSVIASDARPSQAIRASRGSSMRVALELVKEGRAQACVSAGNTGALMGLAKLLLKPLEGIERPALVTVLPHQQKGKTVVLDLGANVDCDSTMLVQFAIMGSVLAEEVVEIPNPRVALLNIGEEEVKGLDSIRDASAVLKTIPSINYIGYLEANELLTGKTDVLVCDGFTGNVTLKTMEGVVRMFLSLLKSQGEGKKRSWWLLLLKRWLQKSLTRRFSHLNPDQYNGACLLGLRGTVIKSHGAANQRAFAVAIEQAVQAVQRQVPQRIAARLESVYPAGFELLDGGKSGTLR

Gene Information

Entrez Gene ID
946165
Gene Name
putative phosphate acyltransferase
Gene Symbol
plsX
Species
Escherichia coli K-12

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IEA:UniProtKB-KW C cytoplasm
GO:0016616 IEA:InterPro F oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0016747 IEA:UniProtKB-EC F transferase activity, transferring acyl groups other than amino-acyl groups
GO:0006633 IEA:InterPro P fatty acid biosynthetic process
GO:0008654 IGI:EcoCyc P phospholipid biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
eco00561 Glycerolipid metabolism
ko00561 Glycerolipid metabolism
eco00564 Glycerophospholipid metabolism
ko00564 Glycerophospholipid metabolism
eco01100 Metabolic pathways

Domain Information

InterPro Annotations

Accession Description
IPR003664 FA_synthesis
IPR024084 Isopropylmalate dehydrogenase-like domain
IPR012281 Phospholipid_synth_PlsX-like

UniProt Annotations

Entry Information

Gene Name
putative phosphate acyltransferase
Protein Entry
PLSX_ECOLI
UniProt ID
P27247
Species
E. coli

Comments

Comment Type Description
Catalytic Activity Acyl-[acyl-carrier-protein] + phosphate = acyl-phosphate + [acyl-carrier-protein]. {ECO:0000255|HAMAP- Rule:MF_00019}.
Function Catalyzes the reversible formation of acyl-phosphate (acyl-PO(4)) from acyl-[acyl-carrier-protein] (acyl-ACP). This enzyme utilizes acyl-ACP as fatty acyl donor, but not acyl-CoA. {ECO:0000255|HAMAP-Rule:MF_00019, ECO:0000269|PubMed:17645809}.
Pathway Lipid metabolism; phospholipid metabolism. {ECO:0000255|HAMAP-Rule:MF_00019}.
Sequence Caution Sequence=AAB59064.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305};
Similarity Belongs to the PlsX family. {ECO:0000255|HAMAP- Rule:MF_00019}.
Subcellular Location Cytoplasm. Note=Associated with the membrane possibly through PlsY. {ECO:0000305}.
Subunit Homodimer. Probably interacts with PlsY. {ECO:0000255|HAMAP-Rule:MF_00019}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007695 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
90111212 RefSeq NP_415608 356 putative phosphate acyltransferase [Escherichia coli str. K-12 substr. MG1655]

Identical Sequences to LMP007695 proteins

Reference Database Accession Length Protein Name
GI:90111212 EMBL CDJ71525.1 356 putative glycerol-3-phosphate acyltransferase PlsX [Escherichia coli str. K-12 substr. MC4100]
GI:90111212 EMBL CDY57137.1 356 fatty acid/phospholipid synthesis protein [Escherichia coli]
GI:90111212 EMBL CDZ19938.1 356 fatty acid/phospholipid synthesis protein [Escherichia coli]
GI:90111212 GenBank KGL69168.1 356 phosphate acyltransferase [Escherichia coli NCTC 50110]
GI:90111212 gnl PRJNA257976 356 putative phosphate acyltransferase [Escherichia coli BW25113]
GI:90111212 gnl IGS 356 putative phosphate acyltransferase [Escherichia coli ER2796]

Related Sequences to LMP007695 proteins

Reference Database Accession Length Protein Name
GI:90111212 GenBank EMD13422.1 356 phosphate acyltransferase [Escherichia coli S17]
GI:90111212 GenBank EOR50697.1 356 putative glycerol-3-phosphate acyltransferase PlsX [Escherichia coli ATCC 25922]
GI:90111212 gnl REF_E.coli 356 glycerol-3-phosphate acyltransferase PlsX [Escherichia coli CFT073]
GI:90111212 gnl jgi 356 fatty acid/phospholipid synthesis protein PlsX [Escherichia coli ATCC 8739]
GI:90111212 gnl REF_jgi 356 putative glycerol-3-phosphate acyltransferase PlsX [Escherichia coli ATCC 8739]
GI:90111212 gnl tigr 356 fatty acid/phospholipid synthesis protein PlsX [Escherichia coli SMS-3-5]