Gene/Proteome Database (LMPD)
LMPD ID
LMP007735
Gene ID
Species
Escherichia coli K-12 (E. coli)
Gene Name
3-oxoacyl-[acyl-carrier-protein] synthase I
Gene Symbol
Synonyms
ECK2317; JW2320; fabC
Summary
There are three -ketoacyl-ACP synthases (KAS) in Escherichia coli: |FRAME: [More information is available at EcoCyc: EG10274].
Orthologs
Proteins
3-oxoacyl-[acyl-carrier-protein] synthase I [Escherichia coli str. K-12 substr. MG1655] | |
---|---|
Refseq ID | NP_416826 |
Protein GI | 16130258 |
UniProt ID | P0A953 |
Length | 406 |
RefSeq Status | REVIEWED |
MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLIDRKVVRFMSDASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAMRGPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVVEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMKMAMHGVDTPIDYLNSHGTSTPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSINIEELDEQAAGLNIVTETTDRELTTVMSNSFGFGGTNATLVMRKLKD |
Gene Information
Entrez Gene ID
Gene Name
3-oxoacyl-[acyl-carrier-protein] synthase I
Gene Symbol
Species
Escherichia coli K-12
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005829 | IDA:UniProtKB | C | cytosol |
GO:0004315 | IDA:EcoCyc | F | 3-oxoacyl-[acyl-carrier-protein] synthase activity |
GO:0006633 | IMP:EcoCyc | P | fatty acid biosynthetic process |
GO:0008610 | IGI:EcoliWiki | P | lipid biosynthetic process |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
eco00780 | Biotin metabolism |
ko00780 | Biotin metabolism |
eco00061 | Fatty acid biosynthesis |
ko00061 | Fatty acid biosynthesis |
eco_M00083 | Fatty acid biosynthesis, elongation |
M00083 | Fatty acid biosynthesis, elongation |
eco01212 | Fatty acid metabolism |
ko01212 | Fatty acid metabolism |
eco01100 | Metabolic pathways |
eco_M00572 | Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP |
M00572 | Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP |
BIOCYC Pathway Links
BIOCYC Pathway ID | Description |
---|---|
PWY-6519 | 8-amino-7-oxononanoate biosynthesis I |
PWY-6519 | 8-amino-7-oxononanoate biosynthesis I |
BIOTIN-BIOSYNTHESIS-PWY | biotin biosynthesis I |
BIOTIN-BIOSYNTHESIS-PWY | biotin biosynthesis I |
PWY0-862 | cis-dodecenoyl biosynthesis |
PWY0-862 | cis-dodecenoyl biosynthesis |
PWY0-862 | cis-dodecenoyl biosynthesis |
PWY-5973 | cis-vaccenate biosynthesis |
PWY-5966 | fatty acid biosynthesis initiation II |
PWY-5966 | fatty acid biosynthesis initiation II |
PWY-5966 | fatty acid biosynthesis initiation II |
PWY-5965 | fatty acid biosynthesis initiation III |
PWY-5965 | fatty acid biosynthesis initiation III |
PWY-5965 | fatty acid biosynthesis initiation III |
FASYN-ELONG-PWY | fatty acid elongation -- saturated |
FASYN-ELONG-PWY | fatty acid elongation -- saturated |
FASYN-ELONG-PWY | fatty acid elongation -- saturated |
PWY-5971 | palmitate biosynthesis II (bacteria and plants) |
PWY-5971 | palmitate biosynthesis II (bacteria and plants) |
PWY-5971 | palmitate biosynthesis II (bacteria and plants) |
PWY-6282 | palmitoleate biosynthesis I |
PWY-6282 | palmitoleate biosynthesis I |
PWY0-881 | superpathway of fatty acid biosynthesis I (E. coli) |
PWY0-881 | superpathway of fatty acid biosynthesis I (E. coli) |
FASYN-INITIAL-PWY | superpathway of fatty acid biosynthesis initiation (E. coli) |
FASYN-INITIAL-PWY | superpathway of fatty acid biosynthesis initiation (E. coli) |
FASYN-INITIAL-PWY | superpathway of fatty acid biosynthesis initiation (E. coli) |
PWY-6285 | superpathway of fatty acids biosynthesis (E. coli) |
PWY-6284 | superpathway of unsaturated fatty acids biosynthesis (E. coli) |
PWY-6284 | superpathway of unsaturated fatty acids biosynthesis (E. coli) |
Domain Information
UniProt Annotations
Entry Information
Gene Name
3-oxoacyl-[acyl-carrier-protein] synthase I
Protein Entry
FABB_ECOLI
UniProt ID
Species
E. coli
Comments
Comment Type | Description |
---|---|
Catalytic Activity | Acyl-[acyl-carrier-protein] + malonyl-[acyl- carrier-protein] = 3-oxoacyl-[acyl-carrier-protein] + CO(2) + [acyl-carrier-protein]. |
Function | Catalyzes the condensation reaction of fatty acid synthesis by the addition to an acyl acceptor of two carbons from malonyl-ACP. Specific for elongation from C-10 to unsaturated C-16 and C-18 fatty acids. {ECO:0000269|PubMed:3076377}. |
Pathway | Lipid metabolism; fatty acid biosynthesis. |
Similarity | Belongs to the beta-ketoacyl-ACP synthases family. {ECO:0000305}. |
Subcellular Location | Cytoplasm. |
Subunit | Homodimer. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007735 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
16130258 | RefSeq | NP_416826 | 406 | 3-oxoacyl-[acyl-carrier-protein] synthase I [Escherichia coli str. K-12 substr. MG1655] |
Identical Sequences to LMP007735 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:16130258 | GenBank | KHI96167.1 | 406 | 3-oxoacyl-ACP synthase [Escherichia coli] |
GI:16130258 | GenBank | KHJ09964.1 | 406 | 3-oxoacyl-ACP synthase [Escherichia coli] |
GI:16130258 | GenBank | KHJ14628.1 | 406 | 3-oxoacyl-ACP synthase [Escherichia coli] |
GI:16130258 | GenBank | KHJ21286.1 | 406 | 3-oxoacyl-ACP synthase [Escherichia coli] |
GI:16130258 | GenBank | KHJ26594.1 | 406 | 3-oxoacyl-ACP synthase [Escherichia coli] |
GI:16130258 | gnl | IGS | 406 | 3-oxoacyl-[acyl-carrier-protein] synthase I [Escherichia coli ER2796] |
Related Sequences to LMP007735 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:16130258 | GenBank | EII96057.1 | 406 | 3-oxoacyl-(acyl carrier protein) synthase I [Escherichia coli TW07793] |
GI:16130258 | GenBank | KDX61032.1 | 406 | 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Escherichia coli 2-210-07_S4_C2] |
GI:16130258 | GenBank | KDX68388.1 | 406 | 3-oxoacyl-[acyl-carrier-protein] synthase 1 [Escherichia coli 2-210-07_S4_C3] |
GI:16130258 | RefSeq | WP_000817171.1 | 406 | 3-oxoacyl-ACP synthase [Escherichia coli] |
GI:16130258 | RefSeq | WP_024224009.1 | 406 | 3-oxoacyl-ACP synthase [Escherichia coli] |
GI:16130258 | RefSeq | WP_032170074.1 | 406 | 3-oxoacyl-ACP synthase [Escherichia coli] |