Gene/Proteome Database (LMPD)
LMPD ID
LMP007746
Gene ID
Species
Escherichia coli K-12 (E. coli)
Gene Name
outer membrane-specific lipoprotein transporter subunit
Gene Symbol
Synonyms
ECK1103; JW5162; ycfV
Summary
LolD is the ATP-binding component of the LolCDE lipoprotein export ABC transporter. [More information is available at EcoCyc: G6574].
Orthologs
Proteins
| outer membrane-specific lipoprotein transporter subunit [Escherichia coli str. K-12 substr. MG1655] | |
|---|---|
| Refseq ID | NP_415635 |
| Protein GI | 90111215 |
| UniProt ID | P75957 |
| Length | 233 |
| RefSeq Status | REVIEWED |
| MNKILLQCDNLCKRYQEGSVQTDVLHNVSFSVGEGEMMAIVGSSGSGKSTLLHLLGGLDTPTSGDVIFNGQPMSKLSSAAKAELRNQKLGFIYQFHHLLPDFTALENVAMPLLIGKKKPAEINSRALEMLKAVGLDHRANHRPSELSGGERQRVAIARALVNNPRLVLADEPTGNLDARNADSIFQLLGELNRLQGTAFLVVTHDLQLAKRMSRQLEMRDGRLTAELSLMGAE | |
Gene Information
Entrez Gene ID
Gene Name
outer membrane-specific lipoprotein transporter subunit
Gene Symbol
Species
Escherichia coli K-12
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0043190 | IEA:UniProtKB-HAMAP | C | ATP-binding cassette (ABC) transporter complex |
| GO:0005886 | IDA:EcoCyc | C | plasma membrane |
| GO:0043234 | IDA:EcoCyc | C | protein complex |
| GO:0016887 | IEA:InterPro | F | ATPase activity |
| GO:0005524 | IEA:UniProtKB-HAMAP | F | ATP binding |
| GO:0042954 | IDA:EcoCyc | F | lipoprotein transporter activity |
| GO:0042953 | IDA:EcoCyc | P | lipoprotein transport |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| eco02010 | ABC transporters |
| ko02010 | ABC transporters |
| eco_M00255 | Lipoprotein-releasing system |
| M00255 | Lipoprotein-releasing system |
Domain Information
UniProt Annotations
Entry Information
Gene Name
outer membrane-specific lipoprotein transporter subunit
Protein Entry
LOLD_ECOLI
UniProt ID
Species
E. coli
Comments
| Comment Type | Description |
|---|---|
| Function | Part of the ABC transporter complex LolCDE involved in the translocation of mature outer membrane-directed lipoproteins, from the inner membrane to the periplasmic chaperone, LolA. Responsible for the formation of the LolA-lipoprotein complex in an ATP-dependent manner. Such a release is dependent of the sorting-signal (absence of an Asp at position 2 of the mature lipoprotein) and of LolA. |
| Similarity | Belongs to the ABC transporter superfamily. Lipoprotein translocase (TC 3.A.1.125) family. {ECO:0000255|HAMAP- Rule:MF_01708}. |
| Similarity | Contains 1 ABC transporter domain. {ECO:0000255|HAMAP- Rule:MF_01708}. |
| Subcellular Location | Cell inner membrane; Peripheral membrane protein. |
| Subunit | The complex is composed of two ATP-binding proteins (LolD) and two transmembrane proteins (LolC and LolE). {ECO:0000255|HAMAP-Rule:MF_01708, ECO:0000269|PubMed:11844772}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007746 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 90111215 | RefSeq | NP_415635 | 233 | outer membrane-specific lipoprotein transporter subunit [Escherichia coli str. K-12 substr. MG1655] |
Identical Sequences to LMP007746 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:90111215 | GenBank | KHJ02987.1 | 233 | lipoprotein ABC transporter ATP-binding protein [Escherichia coli] |
| GI:90111215 | GenBank | KHJ05651.1 | 233 | lipoprotein ABC transporter ATP-binding protein [Escherichia coli] |
| GI:90111215 | GenBank | KHJ10616.1 | 233 | lipoprotein ABC transporter ATP-binding protein [Escherichia coli] |
| GI:90111215 | GenBank | KHJ17543.1 | 233 | lipoprotein ABC transporter ATP-binding protein [Escherichia coli] |
| GI:90111215 | GenBank | KHJ22745.1 | 233 | lipoprotein ABC transporter ATP-binding protein [Escherichia coli] |
| GI:90111215 | gnl | IGS | 233 | outer membrane-specific lipoprotein transporter subunit [Escherichia coli ER2796] |
Related Sequences to LMP007746 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:90111215 | GenBank | EHW40693.1 | 233 | liporeleasing system, ATP-binding protein [Escherichia coli DEC9A] |
| GI:90111215 | GenBank | EHW62012.1 | 233 | liporeleasing system, ATP-binding protein [Escherichia coli DEC9E] |
| GI:90111215 | gnl | zhongguo | 279 | ABC transporter, ATP-binding protein [Escherichia coli P12b] |
| GI:90111215 | RefSeq | YP_006169008.1 | 279 | ABC transporter ATP-binding protein [Escherichia coli P12b] |
| GI:90111215 | RefSeq | WP_001033686.1 | 233 | peptide ABC transporter ATP-binding protein [Escherichia coli] |
| GI:90111215 | RefSeq | WP_014640957.1 | 279 | peptide ABC transporter ATP-binding protein [Escherichia coli] |