Gene/Proteome Database (LMPD)

LMPD ID
LMP007747
Gene ID
948144
Species
Escherichia coli K-12 (E. coli)
Gene Name
lipopolysaccharide 1,6-galactosyltransferase; UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D-galactosyltransferase
Gene Symbol
waaB
Synonyms
ECK3618; JW3603; lps; phx*; rfaB; syn*
Summary
The lipopolysaccharide of Escherichia coli K-12 consists of two major components: the hydrophobic lipid A moiety inserted into the outer membrane and the phosphorylated core oligosaccharide . [More information is available at EcoCyc: EG11351].
Orthologs
View orthologs and multiple alignments for waaB

Proteins

lipopolysaccharide 1,6-galactosyltransferase; UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D-galactosyltransferase [Escherichia coli str. K-12 substr. MG1655]
Refseq ID NP_418085
Protein GI 226524757
UniProt ID P27127
Length 359
RefSeq Status REVIEWED
MKIAFIGEAVSGFGGMETVIRDVITTFRQQHIQSEMFFFCRNDKMDKGWLEGIKYSCSFSNIRLGFLRRAKHIHALSKWLQEYQPDIVICIDVISCLFAAKARKKSGIDMPVFSWPHFSLDHKKHAEYITCADYHLAISSGIKQQMINRGVAESTINVIFNPVETKDSVIPAPEEGETATFIYVGRMKFEGQKRVKDLLDGLSQAKGNWKLHVLGDGSDFEKCQAYGRELNIDDRIVWYGWQQYPWELVQQDIEKVSALLLTSSFEGFPMTLLEALSWGIPCISADCVSGPADIIQPDVNGHLYQPGDIAGFVTLLNKYIAGEIHIEHEKIPASIDEFYQSKYYDRLHKVIISAISRRK

Gene Information

Entrez Gene ID
948144
Gene Name
lipopolysaccharide 1,6-galactosyltransferase; UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D-galactosyltransferase
Gene Symbol
waaB
Species
Escherichia coli K-12

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0008921 IDA:EcoCyc F lipopolysaccharide-1,6-galactosyltransferase activity
GO:0009244 IMP:EcoCyc P lipopolysaccharide core region biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
eco00540 Lipopolysaccharide biosynthesis
ko00540 Lipopolysaccharide biosynthesis
eco01100 Metabolic pathways

BIOCYC Pathway Links

BIOCYC Pathway ID Description
LIPA-CORESYN-PWY Lipid A-core biosynthesis
LIPA-CORESYN-PWY Lipid A-core biosynthesis
LPSSYN-PWY superpathway of lipopolysaccharide biosynthesis
LPSSYN-PWY superpathway of lipopolysaccharide biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR028098 Glyco_trans_4_N
IPR001296 Glycosyl transferase, family 1

UniProt Annotations

Entry Information

Gene Name
lipopolysaccharide 1,6-galactosyltransferase; UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D-galactosyltransferase
Protein Entry
RFAB_ECOLI
UniProt ID
P27127
Species
E. coli

Comments

Comment Type Description
Function Adds a galactose goup to a glucose group of LPS.
Pathway Bacterial outer membrane biogenesis; LPS core biosynthesis.
Sequence Caution Sequence=AAA24085.1; Type=Erroneous initiation; Evidence={ECO:0000305}; Sequence=AAB18605.1; Type=Erroneous initiation; Evidence={ECO:0000305}; Sequence=BAE77664.1; Type=Erroneous initiation; Evidence={ECO:0000305};
Similarity Belongs to the glycosyltransferase group 1 family. Glycosyltransferase 4 subfamily. {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007747 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
226524757 RefSeq NP_418085 359 lipopolysaccharide 1,6-galactosyltransferase; UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D-galactosyltransferase [Escherichia coli str. K-12 substr. MG1655]

Identical Sequences to LMP007747 proteins

Reference Database Accession Length Protein Name
GI:226524757 EMBL CDU41769.1 359 UDP-D-galactose:(Glucosyl)lipopolysaccharide-1,6-D-galactosyltransferase [Escherichia coli]
GI:226524757 EMBL CEE03353.1 359 lipopolysaccharide 1,6-galactosyltransferase [Escherichia coli]
GI:226524757 GenBank KHH63971.1 359 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D-galactosyltransferase [Escherichia coli]
GI:226524757 gnl PRJNA229104 359 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D-galactosyltransferase [Escherichia coli KLY]
GI:226524757 gnl PRJNA257976 359 UDP-D-galactose:(glucosyl)lipopolysaccharide-1, 6-D-galactosyltransferase [Escherichia coli BW25113]
GI:226524757 gnl IGS 359 UDP-D-galactose:(glucosyl)lipopolysaccharide-1, 6-D-galactosyltransferase [Escherichia coli ER2796]

Related Sequences to LMP007747 proteins

Reference Database Accession Length Protein Name
GI:226524757 GenBank AAA24085.1 369 lipopolysaccharide core biosynthesis protein [Escherichia coli]
GI:226524757 GenBank AAB18605.1 369 UDP-D-galactose:(glucosyl)lipopolysaccharide -alpha-1,3-D-galactosyltransferase [Escherichia coli str. K-12 substr. MG1655]
GI:226524757 GenBank ADS49376.1 369 Sequence 52 from patent US 7803637
GI:226524757 GenBank AGV80631.1 369 Sequence 52 from patent US 8524218
GI:226524757 gnl nktd 369 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D-galactosyltransferase [Escherichia coli BW2952]
GI:226524757 gnl REF_nktd 369 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D-galactosyltransferase [Escherichia coli BW2952]