Gene/Proteome Database (LMPD)

LMPD ID
LMP007755
Gene ID
947561
Species
Escherichia coli K-12 (E. coli)
Gene Name
putative glycerol-3-phosphate acyltransferase
Gene Symbol
plsY
Synonyms
ECK3049; JW3031; ygiH
Summary
Homologous to the PlsY acylphosphate:glycerol-3-phosphate acyltransferase (UniProtKB: [More information is available at EcoGene: EG11674]. YgiH is an inner membrane protein with five predicted transmembrane domains. [More information is available at EcoCyc: EG11674].
Orthologs
View orthologs and multiple alignments for plsY

Proteins

putative glycerol-3-phosphate acyltransferase [Escherichia coli str. K-12 substr. MG1655]
Refseq ID NP_417531
Protein GI 16130955
UniProt ID P60782
Length 205
RefSeq Status REVIEWED
MSAIAPGMILIAYLCGSISSAILVCRLCGLPDPRTSGSGNPGATNVLRIGGKGAAVAVLIFDVLKGMLPVWGAYELGVSPFWLGLIAIAACLGHIWPVFFGFKGGKGVATAFGAIAPIGWDLTGVMAGTWLLTVLLSGYSSLGAIVSALIAPFYVWWFKPQFTFPVSMLSCLILLRHHDNIQRLWRRQETKIWTKFKRKREKDPE

Gene Information

Entrez Gene ID
947561
Gene Name
putative glycerol-3-phosphate acyltransferase
Gene Symbol
plsY
Species
Escherichia coli K-12

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005886 IEA:UniProtKB-KW C plasma membrane
GO:0043772 IEA:InterPro F acyl-phosphate glycerol-3-phosphate acyltransferase activity
GO:0004366 IEA:UniProtKB-HAMAP F glycerol-3-phosphate O-acyltransferase activity
GO:0008654 IEA:UniProtKB-HAMAP P phospholipid biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
eco00561 Glycerolipid metabolism
ko00561 Glycerolipid metabolism
eco00564 Glycerophospholipid metabolism
ko00564 Glycerophospholipid metabolism
eco01100 Metabolic pathways

Domain Information

InterPro Annotations

Accession Description
IPR003811 G3P_acylTferase_PlsY

UniProt Annotations

Entry Information

Gene Name
putative glycerol-3-phosphate acyltransferase
Protein Entry
PLSY_ECOLI
UniProt ID
P60782
Species
E. coli

Comments

Comment Type Description
Catalytic Activity Acyl-CoA + sn-glycerol 3-phosphate = CoA + 1- acyl-sn-glycerol 3-phosphate. {ECO:0000269|PubMed:16949372}.
Catalytic Activity Acyl-[acyl-carrier-protein] + sn-glycerol 3- phosphate = [acyl-carrier-protein] + 1-acyl-sn-glycerol 3- phosphate. {ECO:0000269|PubMed:16949372}.
Function Catalyzes the transfer of an acyl group from acyl-ACP to glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA). This enzyme can also utilize acyl-CoA as fatty acyl donor, but not acyl-PO(4) (Probable). {ECO:0000305|PubMed:17645809}.
Pathway Lipid metabolism; phospholipid metabolism.
Similarity Belongs to the PlsY family. {ECO:0000305}.
Subcellular Location Cell inner membrane; Multi-pass membrane protein.
Subunit Probably interacts with PlsX. {ECO:0000250}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007755 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
16130955 RefSeq NP_417531 205 putative glycerol-3-phosphate acyltransferase [Escherichia coli str. K-12 substr. MG1655]

Identical Sequences to LMP007755 proteins

Reference Database Accession Length Protein Name
GI:16130955 GenBank KHJ09358.1 205 glycerol-3-phosphate acyltransferase [Escherichia coli]
GI:16130955 GenBank KHJ10856.1 205 glycerol-3-phosphate acyltransferase [Escherichia coli]
GI:16130955 GenBank KHJ14547.1 205 glycerol-3-phosphate acyltransferase [Escherichia coli]
GI:16130955 GenBank KHJ19524.1 205 glycerol-3-phosphate acyltransferase [Escherichia coli]
GI:16130955 GenBank KHJ23438.1 205 glycerol-3-phosphate acyltransferase [Escherichia coli]
GI:16130955 gnl IGS 205 putative glycerol-3-phosphate acyltransferase [Escherichia coli ER2796]

Related Sequences to LMP007755 proteins

Reference Database Accession Length Protein Name
GI:16130955 GenBank EFZ73782.1 205 hypothetical protein ECRN5871_2916 [Escherichia coli RN587/1]
GI:16130955 GenBank EKI24459.1 205 acyl-phosphate glycerol 3-phosphate acyltransferase [Escherichia coli ARS4.2123]
GI:16130955 GenBank EQQ19022.1 205 glycerol-3-phosphate acyltransferase [Escherichia coli HVH 91 (4-4638751)]
GI:16130955 RefSeq WP_001272793.1 205 glycerol-3-phosphate acyltransferase [Escherichia sp. TW09231]
GI:16130955 RefSeq WP_001272795.1 205 glycerol-3-phosphate acyltransferase [Escherichia coli]
GI:16130955 RefSeq WP_021823956.1 205 glycerol-3-phosphate acyltransferase [Escherichia coli]