Gene/Proteome Database (LMPD)

LMPD ID
LMP007769
Gene ID
945127
Species
Escherichia coli K-12 (E. coli)
Gene Name
acyl-CoA thioesterase 1 and protease I and lysophospholipase L1
Gene Symbol
tesA
Synonyms
ECK0488; JW0483; apeA; pldC
Summary
The TAP complex (TesA) is a broad-specificity esterase that carries out thioesterase, arylesterase, lyophospholipase, and protease activities. [More information is available at EcoCyc: EG11542].
Orthologs
View orthologs and multiple alignments for tesA

Proteins

acyl-CoA thioesterase 1 and protease I and lysophospholipase L1 [Escherichia coli str. K-12 substr. MG1655]
Refseq ID NP_415027
Protein GI 16128478
UniProt ID P0ADA1
Length 208
RefSeq Status REVIEWED
MMNFNNVFRWHLPFLFLVLLTFRAAAADTLLILGDSLSAGYRMSASAAWPALLNDKWQSKTSVVNASISGDTSQQGLARLPALLKQHQPRWVLVELGGNDGLRGFQPQQTEQTLRQILQDVKAANAEPLLMQIRLPANYGRRYNEAFSAIYPKLAKEFDVPLLPFFMEEVYLKPQWMQDDGIHPNRDAQPFIADWMAKQLQPLVNHDS

Gene Information

Entrez Gene ID
945127
Gene Name
acyl-CoA thioesterase 1 and protease I and lysophospholipase L1
Gene Symbol
tesA
Species
Escherichia coli K-12

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0030288 IDA:EcoCyc C outer membrane-bounded periplasmic space
GO:0047617 IDA:EcoCyc F acyl-CoA hydrolase activity
GO:0042802 IDA:EcoCyc F identical protein binding
GO:0004622 IDA:EcoCyc F lysophospholipase activity
GO:0016290 IDA:EcoCyc F palmitoyl-CoA hydrolase activity
GO:0008233 IDA:EcoCyc F peptidase activity
GO:0004620 IDA:EcoCyc F phospholipase activity
GO:0006629 IEA:InterPro P lipid metabolic process

KEGG Pathway Links

KEGG Pathway ID Description
eco01040 Biosynthesis of unsaturated fatty acids
ko01040 Biosynthesis of unsaturated fatty acids

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY-5148 acyl-CoA hydrolysis
PWY-5973 cis-vaccenate biosynthesis
PWY-5973 cis-vaccenate biosynthesis
PWY-6282 palmitoleate biosynthesis I
PWY-6282 palmitoleate biosynthesis I
PWY-6285 superpathway of fatty acids biosynthesis (E. coli)
PWY-6284 superpathway of unsaturated fatty acids biosynthesis (E. coli)
PWY-6284 superpathway of unsaturated fatty acids biosynthesis (E. coli)

Domain Information

InterPro Annotations

Accession Description
IPR001087 Lipase, GDSL
IPR008265 Lipase, GDSL, active site
IPR013831 SGNH_hydro-type_esterase_dom

UniProt Annotations

Entry Information

Gene Name
acyl-CoA thioesterase 1 and protease I and lysophospholipase L1
Protein Entry
TESA_ECOLI
UniProt ID
P0ADA1
Species
E. coli

Comments

Comment Type Description
Catalytic Activity 2-lysophosphatidylcholine + H(2)O = glycerophosphocholine + a carboxylate.
Function Hydrolyzes only long chain acyl thioesters (C12-C18). Specificity similar to chymotrypsin.
Sequence Caution Sequence=AAB40248.1; Type=Erroneous initiation; Evidence={ECO:0000305};
Similarity Belongs to the 'GDSL' lipolytic enzyme family. {ECO:0000305}.
Subcellular Location Periplasm.
Subunit Monomer. {ECO:0000269|PubMed:12842470, ECO:0000269|PubMed:15697222}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007769 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
16128478 RefSeq NP_415027 208 acyl-CoA thioesterase 1 and protease I and lysophospholipase L1 [Escherichia coli str. K-12 substr. MG1655]

Identical Sequences to LMP007769 proteins

Reference Database Accession Length Protein Name
GI:16128478 EMBL CDY55662.1 208 multifunctional acyl-CoA thioesterase I and protease I and lysophospholipase L1 [Escherichia coli]
GI:16128478 EMBL CDZ19358.1 208 multifunctional acyl-CoA thioesterase I and protease I and lysophospholipase L1 [Escherichia coli]
GI:16128478 GenBank KFB92147.1 208 arylesterase [Escherichia coli DSM 30083 = JCM 1649 = ATCC 11775]
GI:16128478 GenBank KGL71912.1 208 esterase [Escherichia coli NCTC 50110]
GI:16128478 gnl PRJNA257976 208 multifunctional acyl-CoA thioesterase 1; protease I; lysophospholipase L1 [Escherichia coli BW25113]
GI:16128478 gnl IGS 208 multifunctional acyl-CoA thioesterase I and protease I and lysophospholipase L1 [Escherichia coli ER2796]

Related Sequences to LMP007769 proteins

Reference Database Accession Length Protein Name
GI:16128478 GenBank KGM64010.1 218 Multifunctional acyl-CoA thioesterase I [Escherichia coli]
GI:16128478 GenBank KGM68486.1 218 Multifunctional acyl-CoA thioesterase I [Escherichia coli]
GI:16128478 GenBank KGM72849.1 218 Multifunctional acyl-CoA thioesterase I [Escherichia coli]
GI:16128478 GenBank KGM77858.1 218 Multifunctional acyl-CoA thioesterase I [Escherichia coli]
GI:16128478 GenBank KGM80742.1 218 Multifunctional acyl-CoA thioesterase I [Escherichia coli]
GI:16128478 gnl goetting 218 acyl-CoA thioesterase I precursor [Escherichia coli ABU 83972]