Gene/Proteome Database (LMPD)

LMPD ID
LMP007804
Gene ID
176857
Species
Caenorhabditis elegans (C. elegans)
Gene Name
Protein SPL-1
Gene Symbol
spl-1
Synonyms
CELE_Y66H1B.4
Alternate Names
Protein SPL-1
Chromosome
IV
EC Number
4.1.2.27

Proteins

Protein SPL-1
Refseq ID NP_499913
Protein GI 17543922
UniProt ID Q9Y194
mRNA ID NM_067512
Length 552
RefSeq Status REVIEWED
MDSVKHTTEIIVDLTKMHYHMINDRLSRYDPVVLVLAAFGGTLVYTKVVHLYRKSEDPILKRMGAYVFSLLRKLPAVRDKIEKELAAEKPKLIESIHKDDKDKQFISTLPIAPLSQDSIMELAKKYEDYNTFNIDGGRVSGAVYTDRHAEHINLLGKIYEKYAFSNPLHPDVFPGARKMEAELIRMVLNLYNGPEDSSGSVTSGGTESIIMACFSYRNRAHSLGIEHPVILACKTAHAAFDKAAHLCGMRLRHVPVDSDNRVDLKEMERLIDSNVCMLVGSAPNFPSGTIDPIPEIAKLGKKYGIPVHVDACLGGFMIPFMNDAGYLIPVFDFRNPGVTSISCDTHKYGCTPKGSSIVMYRSKELHHFQYFSVADWCGGIYATPTIAGSRAGANTAVAWATLLSFGRDEYVRRCAQIVKHTRMLAEKIEKIKWIKPYGKSDVSLVAFSGNGVNIYEVSDKMMKLGWNLNTLQNPAAIHICLTINQANEEVVNAFAVDLEKICEELAAKGEQKADSGMAAMYGMAAQVPKSVVDEVIALYIDATYSAPPSTSN

Gene Information

Entrez Gene ID
176857
Gene Name
Protein SPL-1
Gene Symbol
spl-1
Species
Caenorhabditis elegans

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:UniProtKB-KW C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0016831 IEA:InterPro F carboxy-lyase activity
GO:0030170 IEA:InterPro F pyridoxal phosphate binding
GO:0008117 IEA:UniProtKB-EC F sphinganine-1-phosphate aldolase activity
GO:0019752 IEA:InterPro P carboxylic acid metabolic process
GO:0006665 IEA:UniProtKB-UniPathway P sphingolipid metabolic process

KEGG Pathway Links

KEGG Pathway ID Description
cel01100 Metabolic pathways
cel00600 Sphingolipid metabolism

REACTOME Pathway Links

REACTOME Pathway ID Description
5653216 Sphingolipid de novo biosynthesis
5653217 Sphingolipid metabolism

Domain Information

InterPro Annotations

Accession Description
IPR002129 Pyridoxal phosphate-dependent decarboxylase
IPR015424 Pyridoxal phosphate-dependent transferase
IPR015421 Pyridoxal phosphate-dependent transferase, major region, subdomain 1

UniProt Annotations

Entry Information

Gene Name
Protein SPL-1
Protein Entry
SGPL_CAEEL
UniProt ID
Q9Y194
Species
C. elegans

Comments

Comment Type Description
Catalytic Activity Sphinganine 1-phosphate = phosphoethanolamine + palmitaldehyde. {ECO:0000269|PubMed:12682045}.
Cofactor Name=pyridoxal 5'-phosphate; Xref=ChEBI:CHEBI:597326; Evidence={ECO:0000250};
Developmental Stage Found in the majority of L1 larvae and in all L2, L3 and L4 larvae and adults showing medium to high expression. Highest levels found in older adults. {ECO:0000269|PubMed:12682045}.
Function Cleaves phosphorylated sphingoid bases (PSBs), such as sphingosine-1-phosphate, into fatty aldehydes and phosphoethanolamine. Essential for normal development, intestinal integrity, growth and reproduction. {ECO:0000269|PubMed:12682045}.
Pathway Lipid metabolism; sphingolipid metabolism. {ECO:0000269|PubMed:12682045}.
Similarity Belongs to the group II decarboxylase family. Sphingosine-1-phosphate lyase subfamily. {ECO:0000305}.
Subcellular Location Endoplasmic reticulum membrane {ECO:0000250}; Single-pass type III membrane protein {ECO:0000250}.
Tissue Specificity High expression found in the intestinal cells and faint expression in the head. {ECO:0000269|PubMed:12682045}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007804 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
17543922 RefSeq NP_499913 552 Protein SPL-1

Identical Sequences to LMP007804 proteins

Reference Database Accession Length Protein Name
GI:17543922 EMBL CCD69676.1 552 Protein SPL-1 [Caenorhabditis elegans]
GI:17543922 GenBank AAW19678.1 552 Sequence 11 from patent US 6830881
GI:17543922 GenBank ABW46741.1 552 Sequence 11 from patent US 7262044
GI:17543922 GenBank ADF21396.1 552 Sequence 11 from patent US 7674580
GI:17543922 GenBank AEK15392.1 552 Sequence 11 from patent US 7973143
GI:17543922 SwissProt Q9Y194.1 552 RecName: Full=Sphingosine-1-phosphate lyase; Short=S1PL; Short=SP-lyase; Short=SPL; AltName: Full=Sphingosine-1-phosphate aldolase [Caenorhabditis elegans]

Related Sequences to LMP007804 proteins

Reference Database Accession Length Protein Name
GI:17543922 EMBL CAP29956.1 552 Protein CBR-SPL-1 [Caenorhabditis briggsae]
GI:17543922 EMBL CDJ94709.1 549 Pyridoxal phosphate-dependent decarboxylase domain containing protein [Haemonchus contortus]
GI:17543922 GenBank EFO87349.1 552 CRE-SPL-1 protein [Caenorhabditis remanei]
GI:17543922 GenBank EYC30094.1 550 hypothetical protein Y032_0005g2446 [Ancylostoma ceylanicum]
GI:17543922 RefSeq XP_002634877.1 552 C. briggsae CBR-SPL-1 protein [Caenorhabditis briggsae]
GI:17543922 RefSeq XP_003096219.1 552 CRE-SPL-1 protein [Caenorhabditis remanei]