Gene/Proteome Database (LMPD)
Proteins
| Protein SMS-2 | |
|---|---|
| Refseq ID | NP_508182 |
| Protein GI | 17568105 |
| UniProt ID | Q20735 |
| mRNA ID | NM_075781 |
| Length | 335 |
| RefSeq Status | REVIEWED |
| MTNSSEFTDVLQSRDPCVSNGIVINIDPIDPEPTPIRKEFTCEDTFHHEHHGNSEGFKTLTAFLCLMLSAFLNFFLLTVIHDVVPRQPLPDLTFMIIPQQRWAWSVGDVLSTVSSVVAFTIIFLHHQRWIVLRRTFLLGAIMYGLRAVILGVTFLPPSFHNRDEICQPQVNRTAMYGMEIATRFLTYVITLGLTSGQDKILCGDLMFSGHTVVLTIMYFVQLQYTPRGLVILRYIAAPITFLGIAALVVSGGHYTMDVLIAYWLTSHVFWSYHQIFEMRKDDRPQAPLSRLWWFWLCYWFESDVADGKLVNKWNWPLEGPQRMHTIMNRINYKLQ | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | NAS:UniProtKB | C | integral component of membrane |
| GO:0047493 | ISS:UniProtKB | F | ceramide cholinephosphotransferase activity |
| GO:0033188 | ISS:UniProtKB | F | sphingomyelin synthase activity |
| GO:0006686 | ISS:UniProtKB | P | sphingomyelin biosynthetic process |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR025749 | Sphingomyelin synthase-like domain |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | A ceramide + a phosphatidylcholine = a sphingomyelin + a 1,2-diacyl-sn-glycerol. |
| Function | Sphingomyelin synthases synthesize the sphingolipid, sphingomyelin, through transfer of the phosphatidyl head group, phosphatidylcholine, on to the primary hydroxyl of ceramide. The reaction is bidirectional depending on the respective levels of the sphingolipid and ceramide. |
| Pathway | Lipid metabolism; sphingolipid metabolism. |
| Similarity | Belongs to the sphingomyelin synthase family. |
| Subcellular Location | Membrane ; Multi-pass membrane protein . |
Identical and Related Proteins
Unique RefSeq proteins for LMP007809 (as displayed in Record Overview)
Identical Sequences to LMP007809 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:17568105 | EMBL | CCD67244.1 | 335 | Protein SMS-2 [Caenorhabditis elegans] |
| GI:17568105 | SwissProt | Q20735.1 | 335 | RecName: Full=Phosphatidylcholine:ceramide cholinephosphotransferase 2; AltName: Full=Sphingomyelin synthase 2 [Caenorhabditis elegans] |
Related Sequences to LMP007809 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:17568105 | EMBL | CAP27982.1 | 336 | Protein CBR-SMS-2 [Caenorhabditis briggsae] |
| GI:17568105 | GenBank | EFO96882.1 | 335 | CRE-SMS-2 protein [Caenorhabditis remanei] |
| GI:17568105 | GenBank | EGT54911.1 | 335 | CBN-SMS-2 protein [Caenorhabditis brenneri] |
| GI:17568105 | GenBank | EYC45116.1 | 392 | hypothetical protein Y032_0438g1475 [Ancylostoma ceylanicum] |
| GI:17568105 | RefSeq | XP_002643221.1 | 336 | C. briggsae CBR-SMS-2 protein [Caenorhabditis briggsae] |
| GI:17568105 | RefSeq | XP_003107042.1 | 335 | CRE-SMS-2 protein [Caenorhabditis remanei] |