Gene/Proteome Database (LMPD)
Proteins
Protein MBOA-7 | |
---|---|
Refseq ID | NP_509760 |
Protein GI | 133958222 |
UniProt ID | Q19468 |
mRNA ID | NM_077359 |
Length | 453 |
RefSeq Status | REVIEWED |
MENILGLMSKDDWIYTGLLLFSFGASCYVRKIGNNILASGALGFAMSLFIIGPKIVYSLGICSIAISIQLLANKKSTPLYVFLTTFTYLMFVRFAHYILPVNEVASHTNVIQLIITLRIIGITFEENDAWVHKSDENPTKRYLTELPTILEKFAYFYHFCGLFTGPYYTYQMLIDSQNPILKSWDPTLEVKSRFVRLLWSVPVFVITNHYFPLDILRSDAIWEVSFFTRLVYAALIFVVFKTRVYSAWAIAESICVILGIGIYPAASNPKIIMGPTDLNAFDKLKTRENIEMSSDAIVNLDIPKVEFSDGFRDGMKAWNRSVQTWLALYVHSRVKVMRVETTMLVSAVWHGTYAGYFMSFGVVAMCAILEDVIFKLVPVDTETGVRPKWFRILYTHTIRCRGFEMLATGFLLKNAYDVHHFWSSIYYWLPLLCIPFYIYSAKISKPKKAQKSE |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0043231 | IDA:WormBase | C | intracellular membrane-bounded organelle |
GO:0008374 | IDA:WormBase | F | O-acyltransferase activity |
GO:0035264 | IGI:WormBase | P | multicellular organism growth |
GO:0002119 | IMP:WormBase | P | nematode larval development |
GO:0018991 | IMP:WormBase | P | oviposition |
GO:0006661 | IDA:WormBase | P | phosphatidylinositol biosynthetic process |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR004299 | Membrane bound O-acyl transferase, MBOAT |
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Catalytic Activity | Acyl-CoA + 1-acyl-sn-glycero-3- phosphatidylinositol = CoA + 1,2-diacyl-sn-glycero-3- phosphatidylinositol. |
Catalytic Activity | Acyl-[acyl-carrier-protein] + 1-acyl-sn- glycerol 3-phosphate = [acyl-carrier-protein] + 1,2-diacyl-sn- glycerol 3-phosphate. |
Disruption Phenotype | Mutants show larval arrest at an early developmental stage and egg-laying defects; 14% of mutants accumulate unlaid eggs that hatched internally. |
Function | Acyltransferase which mediates the conversion of lysophosphatidylinositol (1-acyl-sn-glycero-3-phosphatidylinositol or LPI) into phosphatidylinositol (1,2-diacyl-sn-glycero-3- phosphoinositol or PI) (LPIAT activity). Prefers arachidonoyl-CoA or eicosapentaenoic acid (EPA) as the acyl donor. Prefers sn-2-LPI rather than sn-1-LPI as the acyl acceptor. Lysophospholipid acyltransferases (LPLATs) catalyze the reacylation step of the phospholipid remodeling pathway also known as the Lands cycle. |
Pathway | Lipid metabolism; phospholipid metabolism. |
Similarity | Belongs to the membrane-bound acyltransferase family. |
Subcellular Location | Membrane ; Multi-pass membrane protein . |
Tissue Specificity | Expressed ubiquitously throughout development from early embryo to larval and adult stages. In adults, strongly expressed in pharyngeal muscle, body wall muscle, vulval cells, distal tip cells, intestinal cells and spermatheca. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007834 (as displayed in Record Overview)
Identical Sequences to LMP007834 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:133958222 | EMBL | CAA90185.2 | 453 | Protein MBOA-7 [Caenorhabditis elegans] |
GI:133958222 | GenBank | ABV66274.1 | 453 | lysophosphatidylinositol acyltransferase [Caenorhabditis elegans] |
GI:133958222 | SwissProt | Q19468.2 | 453 | RecName: Full=Lysophospholipid acyltransferase 7; Short=LPLAT 7; AltName: Full=1-acylglycerophosphatidylinositol O-acyltransferase; AltName: Full=Lysophosphatidylinositol acyltransferase; Short=LPIAT; Short=Lyso-PI acyltransferase; AltName: Full=Membrane-bound O-acyltransferase domain-containing protein 7 [Caenorhabditis elegans] |
Related Sequences to LMP007834 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:133958222 | EMBL | CAP25198.1 | 452 | Protein CBR-MBOA-7 [Caenorhabditis briggsae] |
GI:133958222 | GenBank | EFO89701.1 | 455 | CRE-MBOA-7 protein [Caenorhabditis remanei] |
GI:133958222 | GenBank | EGT59425.1 | 455 | CBN-MBOA-7 protein [Caenorhabditis brenneri] |
GI:133958222 | RefSeq | XP_002644127.1 | 452 | C. briggsae CBR-TAG-289 protein [Caenorhabditis briggsae] |
GI:133958222 | RefSeq | XP_003109559.1 | 455 | CRE-MBOA-7 protein [Caenorhabditis remanei] |
GI:133958222 | SwissProt | A8WXS4.1 | 452 | RecName: Full=Lysophospholipid acyltransferase 7; Short=LPLAT 7; AltName: Full=1-acylglycerophosphatidylinositol O-acyltransferase; AltName: Full=Lysophosphatidylinositol acyltransferase; Short=LPIAT; Short=Lyso-PI acyltransferase; AltName: Full=Membrane-bound O-acyltransferase domain-containing protein 7 [Caenorhabditis briggsae] |