Gene/Proteome Database (LMPD)
Proteins
Protein ELO-2 | |
---|---|
Refseq ID | NP_503114 |
Protein GI | 17539766 |
UniProt ID | Q9XVQ9 |
mRNA ID | NM_070713 |
Length | 274 |
RefSeq Status | REVIEWED |
MAAAQTSPAATLVDVLTKPWSLDQTDSYMSTFVPLSYKIMIGYLVTIYFGQKLMAHRKPFDLQNTLALWNFGFSLFSGIAAYKLIPELFGVFMKDGFVASYCQNENYYTDASTGFWGWAFVMSKAPELGDTMFLVLRKKPVIFMHWYHHALTFVYAVVTYSEHQAWARWSLALNLAVHTVMYFYFAVRALNIQTPRPVAKFITTIQIVQFVISCYIFGHLVFIKSADSVPGCAVSWNVLSIGGLMYISYLFLFAKFFYKAYIQKRSPTKTSKQE |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0016740 | IEA:UniProtKB-KW | F | transferase activity |
GO:0008340 | IMP:WormBase | P | determination of adult lifespan |
GO:0006633 | IEA:UniProtKB-KW | P | fatty acid biosynthetic process |
GO:0006629 | IMP:WormBase | P | lipid metabolic process |
GO:0035264 | IMP:WormBase | P | multicellular organism growth |
GO:0010468 | IMP:WormBase | P | regulation of gene expression |
GO:0000003 | IMP:WormBase | P | reproduction |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR002076 | ELO family |
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Catalytic Activity | A very-long-chain acyl-CoA + malonyl-CoA = CoA + a very-long-chain 3-oxoacyl-CoA + CO(2). |
Similarity | Belongs to the ELO family. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007875 (as displayed in Record Overview)
Identical Sequences to LMP007875 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:17539766 | EMBL | CAB02921.1 | 274 | Protein ELO-2 [Caenorhabditis elegans] |
Related Sequences to LMP007875 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:17539766 | EMBL | CAP21889.1 | 271 | Protein CBR-ELO-2 [Caenorhabditis briggsae] |
GI:17539766 | EMBL | CDJ96509.1 | 268 | GNS1 SUR4 membrane protein domain containing protein [Haemonchus contortus] |
GI:17539766 | EMBL | CDJ84522.1 | 268 | GNS1 SUR4 membrane protein domain containing protein [Haemonchus contortus] |
GI:17539766 | GenBank | EFP03829.1 | 273 | CRE-ELO-2 protein [Caenorhabditis remanei] |
GI:17539766 | RefSeq | XP_002632413.1 | 271 | C. briggsae CBR-ELO-2 protein [Caenorhabditis briggsae] |
GI:17539766 | RefSeq | XP_003103455.1 | 273 | CRE-ELO-2 protein [Caenorhabditis remanei] |