Gene/Proteome Database (LMPD)
Proteins
| Protein ACL-1 | |
|---|---|
| Refseq ID | NP_510606 |
| Protein GI | 17568319 |
| UniProt ID | Q93841 |
| mRNA ID | NM_078205 |
| Length | 262 |
| MTFLAILFVIAVLLLLAQLPVIGFYIRAVYFGMCLIIGGFLGGLASIPFGKSPNNHFRMFKIFQAMTWPMGVRFELRNSEILHDKKPYIIIANHQSALDVLGMSFAWPVDCVVMLKSSLKYLPGFNLCAYLCDSVYINRFSKEKALKTVDTTLHEIVTKKRKVWIYPEGTRNAEPELLPFKKGAFILAKQAKIPIVPCVFSSHKFFYSHAEKRLTSGNCIIDILPEVDSSKFDSIDDLSAHCRKIMQAHREKLDAEAANLNI | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0003841 | IEA:UniProtKB-EC | F | 1-acylglycerol-3-phosphate O-acyltransferase activity |
| GO:0016024 | IEA:UniProtKB-UniPathway | P | CDP-diacylglycerol biosynthetic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| cel00561 | Glycerolipid metabolism |
| ko00561 | Glycerolipid metabolism |
| cel00564 | Glycerophospholipid metabolism |
| ko00564 | Glycerophospholipid metabolism |
| cel01100 | Metabolic pathways |
| cel_M00089 | Triacylglycerol biosynthesis |
| M00089 | Triacylglycerol biosynthesis |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Acyl-CoA + 1-acyl-sn-glycerol 3-phosphate = CoA + 1,2-diacyl-sn-glycerol 3-phosphate. |
| Domain | The HXXXXD motif is essential for acyltransferase activity and may constitute the binding site for the phosphate moiety of the glycerol-3-phosphate |
| Domain | The HXXXXD motif is essential for acyltransferase activity and may constitute the binding site for the phosphate moiety of the glycerol-3-phosphate. {ECO:0000250}. |
| Function | Converts lysophosphatidic acid (LPA) into phosphatidic acid by incorporating an acyl moiety at the sn-2 position of the glycerol backbone |
| Function | Converts lysophosphatidic acid (LPA) into phosphatidic acid by incorporating an acyl moiety at the sn-2 position of the glycerol backbone. {ECO:0000250}. |
| Pathway | Phospholipid metabolism; CDP-diacylglycerol biosynthesis; CDP-diacylglycerol from sn-glycerol 3-phosphate: step 2/3. |
| Similarity | Belongs to the 1-acyl-sn-glycerol-3-phosphate acyltransferase family |
| Similarity | Belongs to the 1-acyl-sn-glycerol-3-phosphate acyltransferase family. {ECO:0000305}. |
| Subcellular Location | Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. |
| Subcellular Location | Membrane ; Multi-pass membrane protein . |
Identical and Related Proteins
Unique RefSeq proteins for LMP007896 (as displayed in Record Overview)
Identical Sequences to LMP007896 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP007896 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|