Gene/Proteome Database (LMPD)

LMPD ID
LMP007919
Gene ID
Species
Caenorhabditis elegans (C. elegans)
Gene Name
Protein DAD-1
Gene Symbol
Synonyms
CELE_F57B10.10
Alternate Names
Protein DAD-1
Chromosome
I
EC Number
2.4.99.18

Proteins

Protein DAD-1
Refseq ID NP_491889
Protein GI 17506415
UniProt ID P52872
mRNA ID NM_059488
Length 113
RefSeq Status REVIEWED
MAAQVVPVLSKLFDDYQKTTSSKLKIIDAYMTYILFTGIFQFIYCLLVGTFPFNSFLSGFISTVTSFVLASCLRMQVNQENRSEFTAVSTERAFADFIFANLILHLVVVNFLG

Gene Information

Entrez Gene ID
Gene Name
Protein DAD-1
Gene Symbol
Species
Caenorhabditis elegans

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0008250 IEA:InterPro C oligosaccharyltransferase complex
GO:0004579 IEA:InterPro F dolichyl-diphosphooligosaccharide-protein glycotransferase activity
GO:0006915 IEA:UniProtKB-KW P apoptotic process
GO:0043066 IDA:WormBase P negative regulation of apoptotic process
GO:0006486 IEA:UniProtKB-UniPathway P protein glycosylation

KEGG Pathway Links

KEGG Pathway ID Description
cel01100 Metabolic pathways
cel00510 N-Glycan biosynthesis
cel04141 Protein processing in endoplasmic reticulum
ko04141 Protein processing in endoplasmic reticulum

Domain Information

InterPro Annotations

Accession Description
IPR003038 DAD/Ost2

UniProt Annotations

Entry Information

Gene Name
Protein DAD-1
Protein Entry
DAD1_CAEEL
UniProt ID
Species
C. elegans

Comments

Comment Type Description
Catalytic Activity Dolichyl diphosphooligosaccharide + [protein]- L-asparagine = dolichyl diphosphate + a glycoprotein with the oligosaccharide chain attached by N-beta-D-glycosyl linkage to a protein L-asparagine.
Function Essential subunit of the N-oligosaccharyl transferase (OST) complex which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains (By similarity). Possesses cell death- inhibiting activity. Suppresses some programmed cell death in C.elegans. {ECO:0000250}.
Pathway Protein modification; protein glycosylation.
Similarity Belongs to the DAD/OST2 family. {ECO:0000305}.
Subcellular Location Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}.
Subunit Component of the oligosaccharyltransferase (OST) complex. {ECO:0000250}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007919 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
17506415 RefSeq NP_491889 113 Protein DAD-1

Identical Sequences to LMP007919 proteins

Reference Database Accession Length Protein Name
GI:17506415 EMBL CAA61451.1 113 dad-1 [Caenorhabditis elegans]
GI:17506415 EMBL CCD71478.1 113 Protein DAD-1 [Caenorhabditis elegans]
GI:17506415 GenBank AGU20743.1 113 Sequence 128 from patent US 8519225
GI:17506415 SwissProt P52872.1 113 RecName: Full=Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit dad-1; Short=Oligosaccharyl transferase subunit dad-1; AltName: Full=Defender against cell death 1; Short=Protein dad-1 [Caenorhabditis elegans]

Related Sequences to LMP007919 proteins

Reference Database Accession Length Protein Name
GI:17506415 EMBL CAP31606.1 113 Protein CBR-DAD-1 [Caenorhabditis briggsae]
GI:17506415 GenBank EFP11693.1 129 CRE-DAD-1 protein [Caenorhabditis remanei]
GI:17506415 GenBank EGT38791.1 113 CBN-DAD-1 protein [Caenorhabditis brenneri]
GI:17506415 GenBank EYC23235.1 111 hypothetical protein Y032_0015g2540 [Ancylostoma ceylanicum]
GI:17506415 RefSeq XP_002640159.1 113 C. briggsae CBR-DAD-1 protein [Caenorhabditis briggsae]
GI:17506415 RefSeq XP_003099086.1 129 CRE-DAD-1 protein [Caenorhabditis remanei]