Gene/Proteome Database (LMPD)
Proteins
Protein FAR-2 | |
---|---|
Refseq ID | NP_499011 |
Protein GI | 17553790 |
UniProt ID | P34383 |
mRNA ID | NM_066610 |
Length | 182 |
RefSeq Status | REVIEWED |
MIRAFLVVALASVAVFSAPIPEVPQNFDDIPAEYKGLIPAEVAEHLKAITAEEKAALKELAQNHKEYKTEEEFKAALKEKSPSLYEKAGKLEALLTAKFEKLDATAQALVKKIIAKGRELHQQYLAGDKPTLDSLKELAKGYIAEYKALSDDAKATITAEFPILTGFFQNEKIQAIVGQYVN |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005576 | IEA:UniProtKB-KW | C | extracellular region |
GO:0005504 | ISS:WormBase | F | fatty acid binding |
GO:0019841 | ISS:WormBase | F | retinol binding |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR008632 | Nematode fatty acid retinoid binding |
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Function | Probably binds lipids. {ECO:0000250}. |
Interaction | Q21453:M01F1.4; NbExp=1; IntAct=EBI-318195, EBI-312060; |
Similarity | Belongs to the fatty-acid and retinol-binding protein (FARBP) family. {ECO:0000305}. |
Subcellular Location | Secreted {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007971 (as displayed in Record Overview)
Identical Sequences to LMP007971 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:17553790 | EMBL | CAA79617.1 | 182 | Protein FAR-2 [Caenorhabditis elegans] |
GI:17553790 | SwissProt | P34383.1 | 182 | RecName: Full=Fatty-acid and retinol-binding protein 2; Flags: Precursor [Caenorhabditis elegans] |
Related Sequences to LMP007971 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:17553790 | EMBL | CAP27057.1 | 182 | Protein CBR-FAR-2 [Caenorhabditis briggsae] |
GI:17553790 | GenBank | ACD86940.1 | 164 | fatty acid/retinol binding protein, partial [Caenorhabditis brenneri] |
GI:17553790 | GenBank | EFO96592.1 | 182 | CRE-FAR-2 protein [Caenorhabditis remanei] |
GI:17553790 | GenBank | EGT56780.1 | 183 | hypothetical protein CAEBREN_13317 [Caenorhabditis brenneri] |
GI:17553790 | RefSeq | XP_002642414.1 | 182 | C. briggsae CBR-FAR-2 protein [Caenorhabditis briggsae] |
GI:17553790 | RefSeq | XP_003092680.1 | 182 | CRE-FAR-2 protein [Caenorhabditis remanei] |