Gene/Proteome Database (LMPD)
Proteins
Protein FAT-7 | |
---|---|
Refseq ID | NP_504814 |
Protein GI | 17561776 |
UniProt ID | G5EGH6 |
mRNA ID | NM_072413 |
Length | 338 |
RefSeq Status | REVIEWED |
MTVKTRASIAKKIEKDGLDSQYLFMDPNEVLQVQEESKKIPYKMEIVWRNVALFAALHVAAAIGLYELVFHAKWQTAVFSFALYVFSGFGITAGAHRLWSHKSYKATTPMRIFLMLLNNIALQNDIIEWARDHRCHHKWTDTDADPHNTTRGFFFTHMGWLLVRKHPQVKEHGGKLDLSDLFSDPVLVFQRKHYFPLVILFCFILPTIIPVYFWKETAFIAFYVAGTFRYCFTLHATWCINSAAHYFGWKPYDTSVSAVENVFTTVVAVGEGGHNFHHTFPQDYRASEYSLIYNWTRVLIDTAAVLGLVYDRKTIADEFISRQVANHGSEESRKKSIM |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005789 | TAS:WormBase | C | endoplasmic reticulum membrane |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0004768 | IDA:WormBase | F | stearoyl-CoA 9-desaturase activity |
GO:0006633 | IDA:WormBase | P | fatty acid biosynthetic process |
GO:0007275 | IGI:WormBase | P | multicellular organismal development |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Domain | The histidine box domains may contain the active site and/or be involved in metal ion binding. {ECO:0000250}. |
Function | Delta(9)-fatty-acid desaturase that acts preferentially on stearoyl-CoA. Also acts on vaccenyl-coA, heptadecanyol-CoA, and palmitoyl-CoA. {ECO:0000269|PubMed:10872837, ECO:0000269|PubMed:16839188}. |
Similarity | Belongs to the fatty acid desaturase family. {ECO:0000305}. |
Subcellular Location | Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP008011 (as displayed in Record Overview)
Identical Sequences to LMP008011 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:17561776 | EMBL | CAD20543.1 | 338 | unnamed protein product [Caenorhabditis elegans] |
GI:17561776 | EMBL | CCD69123.1 | 338 | Protein FAT-7 [Caenorhabditis elegans] |
GI:17561776 | GenBank | AAF97549.1 | 338 | stearoyl-CoA desaturase FAT-7 [Caenorhabditis elegans] |
GI:17561776 | GenBank | ABZ32440.1 | 338 | Sequence 6378 from patent US 7314974 |
GI:17561776 | SwissProt | G5EGH6.1 | 338 | RecName: Full=Delta(9)-fatty-acid desaturase fat-7; AltName: Full=Fatty-acid desaturase 7; AltName: Full=Stearoyl-CoA desaturase fat-7 [Caenorhabditis elegans] |
Related Sequences to LMP008011 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:17561776 | EMBL | CAB08356.1 | 339 | Protein FAT-6, isoform a [Caenorhabditis elegans] |
GI:17561776 | EMBL | CAD20542.1 | 339 | unnamed protein product [Caenorhabditis elegans] |
GI:17561776 | GenBank | AAF97550.1 | 339 | stearoyl-CoA desaturase FAT-6 [Caenorhabditis elegans] |
GI:17561776 | GenBank | ABZ32252.1 | 339 | Sequence 6190 from patent US 7314974 |
GI:17561776 | RefSeq | NP_001255595.1 | 339 | Protein FAT-6, isoform a [Caenorhabditis elegans] |
GI:17561776 | SwissProt | G5EGN2.1 | 339 | RecName: Full=Delta(9)-fatty-acid desaturase fat-6; AltName: Full=Fatty-acid desaturase 6; AltName: Full=Stearoyl-CoA desaturase fat-6 [Caenorhabditis elegans] |