Gene/Proteome Database (LMPD)

LMPD ID
LMP008011
Gene ID
Species
Caenorhabditis elegans (C. elegans)
Gene Name
Protein FAT-7
Gene Symbol
Synonyms
CELE_F10D2.9
Alternate Names
Protein FAT-7
Chromosome
V
EC Number
1.14.19.-

Proteins

Protein FAT-7
Refseq ID NP_504814
Protein GI 17561776
UniProt ID G5EGH6
mRNA ID NM_072413
Length 338
RefSeq Status REVIEWED
MTVKTRASIAKKIEKDGLDSQYLFMDPNEVLQVQEESKKIPYKMEIVWRNVALFAALHVAAAIGLYELVFHAKWQTAVFSFALYVFSGFGITAGAHRLWSHKSYKATTPMRIFLMLLNNIALQNDIIEWARDHRCHHKWTDTDADPHNTTRGFFFTHMGWLLVRKHPQVKEHGGKLDLSDLFSDPVLVFQRKHYFPLVILFCFILPTIIPVYFWKETAFIAFYVAGTFRYCFTLHATWCINSAAHYFGWKPYDTSVSAVENVFTTVVAVGEGGHNFHHTFPQDYRASEYSLIYNWTRVLIDTAAVLGLVYDRKTIADEFISRQVANHGSEESRKKSIM

Gene Information

Entrez Gene ID
Gene Name
Protein FAT-7
Gene Symbol
Species
Caenorhabditis elegans

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005789 TAS:WormBase C endoplasmic reticulum membrane
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0004768 IDA:WormBase F stearoyl-CoA 9-desaturase activity
GO:0006633 IDA:WormBase P fatty acid biosynthetic process
GO:0007275 IGI:WormBase P multicellular organismal development

KEGG Pathway Links

KEGG Pathway ID Description
cel01040 Biosynthesis of unsaturated fatty acids
ko01040 Biosynthesis of unsaturated fatty acids
cel01212 Fatty acid metabolism
ko01212 Fatty acid metabolism

Domain Information

InterPro Annotations

Accession Description
IPR005804 Fatty acid desaturase, type 1
IPR015876 Fatty acid desaturase, type 1, core

UniProt Annotations

Entry Information

Gene Name
Protein FAT-7
Protein Entry
FAT7_CAEEL
UniProt ID
Species
C. elegans

Comments

Comment Type Description
Domain The histidine box domains may contain the active site and/or be involved in metal ion binding. {ECO:0000250}.
Function Delta(9)-fatty-acid desaturase that acts preferentially on stearoyl-CoA. Also acts on vaccenyl-coA, heptadecanyol-CoA, and palmitoyl-CoA. {ECO:0000269|PubMed:10872837, ECO:0000269|PubMed:16839188}.
Similarity Belongs to the fatty acid desaturase family. {ECO:0000305}.
Subcellular Location Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP008011 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
17561776 RefSeq NP_504814 338 Protein FAT-7

Identical Sequences to LMP008011 proteins

Reference Database Accession Length Protein Name
GI:17561776 EMBL CAD20543.1 338 unnamed protein product [Caenorhabditis elegans]
GI:17561776 EMBL CCD69123.1 338 Protein FAT-7 [Caenorhabditis elegans]
GI:17561776 GenBank AAF97549.1 338 stearoyl-CoA desaturase FAT-7 [Caenorhabditis elegans]
GI:17561776 GenBank ABZ32440.1 338 Sequence 6378 from patent US 7314974
GI:17561776 SwissProt G5EGH6.1 338 RecName: Full=Delta(9)-fatty-acid desaturase fat-7; AltName: Full=Fatty-acid desaturase 7; AltName: Full=Stearoyl-CoA desaturase fat-7 [Caenorhabditis elegans]

Related Sequences to LMP008011 proteins

Reference Database Accession Length Protein Name
GI:17561776 EMBL CAB08356.1 339 Protein FAT-6, isoform a [Caenorhabditis elegans]
GI:17561776 EMBL CAD20542.1 339 unnamed protein product [Caenorhabditis elegans]
GI:17561776 GenBank AAF97550.1 339 stearoyl-CoA desaturase FAT-6 [Caenorhabditis elegans]
GI:17561776 GenBank ABZ32252.1 339 Sequence 6190 from patent US 7314974
GI:17561776 RefSeq NP_001255595.1 339 Protein FAT-6, isoform a [Caenorhabditis elegans]
GI:17561776 SwissProt G5EGN2.1 339 RecName: Full=Delta(9)-fatty-acid desaturase fat-6; AltName: Full=Fatty-acid desaturase 6; AltName: Full=Stearoyl-CoA desaturase fat-6 [Caenorhabditis elegans]