Gene/Proteome Database (LMPD)

LMPD ID
LMP008017
Gene ID
Species
Caenorhabditis elegans (C. elegans)
Gene Name
Protein DAF-36
Gene Symbol
Synonyms
CELE_C12D8.5
Alternate Names
Protein DAF-36
Chromosome
V
EC Number
1.3.1.21

Proteins

Protein DAF-36
Refseq ID NP_505629
Protein GI 71983709
UniProt ID Q17938
mRNA ID NM_073228
Length 428
RefSeq Status REVIEWED
MLLEQIWGFLTAHPISVVTTILIVYLIHITLKPLNRVRRLGDVGLFFGKPELKGFYRERQLERLKLLRRVGDMPPVFPNGWYCVCESEKLANNQIMEITVLGQFLSLIRSESGAVYITDSYCPHIGANFNIGGRVVRDNCIQCPFHGWIFSAETGKCVEVPYDEGRIPEQAKVTTWPCIERNNNIYLWYHCDGAEPEWEIPEITEITDGFWHLGGRTEHEVMCHIQEIPENGADIAHLNYLHKSAPPVTKGSDIIKTDLSDPQPAVQHVWDGKWEVKSEEDRHCGVMHLNQFMTFWGYKVPLTSSKLVAEQHGPGIVHMLFDFGIWGKGVVFQTVTPEEALLQRVRFRIFSNIPWFFVKFFMTVEAMQFERDVFIWSNKKYIKSPLLVKNDGPIQKHRRWFSQFYTENSPKMLKDGSLSNQAKSIFDW

Gene Information

Entrez Gene ID
Gene Name
Protein DAF-36
Gene Symbol
Species
Caenorhabditis elegans

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IDA:WormBase C cytoplasm
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0051537 IEA:UniProtKB-KW F 2 iron, 2 sulfur cluster binding
GO:0047598 IEA:UniProtKB-EC F 7-dehydrocholesterol reductase activity
GO:0046872 IEA:UniProtKB-KW F metal ion binding
GO:0008203 IEA:UniProtKB-KW P cholesterol metabolic process

Domain Information

InterPro Annotations

Accession Description
IPR017941 Rieske [2Fe-2S] iron-sulphur domain

UniProt Annotations

Entry Information

Gene Name
Protein DAF-36
Protein Entry
DAF36_CAEEL
UniProt ID
Species
C. elegans

Comments

Comment Type Description
Catalytic Activity Cholesterol + NADP(+) = cholesta-5,7-dien-3- beta-ol + NADPH. {ECO:0000269|PubMed:21632547, ECO:0000269|PubMed:21749634}.
Cofactor Name=[2Fe-2S] cluster; Xref=ChEBI:CHEBI:49601; Evidence={ECO:0000255|PROSITE-ProRule:PRU00628}; Note=Binds 1 [2Fe-2S] cluster per subunit. {ECO:0000255|PROSITE- ProRule:PRU00628};
Function Catalyzes the production of 7-dehydrocholesterol (7-DHC) by the desaturation of the C7-C8 single bond of cholesterol. This reaction is the first step in the synthesis of the steroid hormone delta(7)-dafachronic acid. Dafachronic acids bind directly to the nuclear hormone receptor (NHR) daf-12, suppressing dauer formation and inducing reproductive growth. {ECO:0000269|PubMed:16563875, ECO:0000269|PubMed:21632547, ECO:0000269|PubMed:21749634}.
Pathway Steroid hormone biosynthesis; dafachronic acid biosynthesis. {ECO:0000269|PubMed:21632547, ECO:0000269|PubMed:21749634}.
Similarity Contains 1 Rieske domain. {ECO:0000255|PROSITE- ProRule:PRU00628}.
Subcellular Location Membrane {ECO:0000305}; Single-pass membrane protein {ECO:0000305}.
Tissue Specificity Expressed in intestine at all postembryonic stages, including dauer. Expression is reduced in daf-2 mutants. {ECO:0000269|PubMed:16563875}.

Identical and Related Proteins

Unique RefSeq proteins for LMP008017 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
71983709 RefSeq NP_505629 428 Protein DAF-36

Identical Sequences to LMP008017 proteins

Reference Database Accession Length Protein Name
GI:71983709 EMBL CAA98235.2 428 Protein DAF-36 [Caenorhabditis elegans]
GI:71983709 SwissProt Q17938.2 428 RecName: Full=Cholesterol desaturase daf-36 [Caenorhabditis elegans]

Related Sequences to LMP008017 proteins

Reference Database Accession Length Protein Name
GI:71983709 EMBL CAP29052.2 430 Protein CBR-DAF-36 [Caenorhabditis briggsae]
GI:71983709 GenBank EFO99512.1 428 CRE-DAF-36 protein [Caenorhabditis remanei]
GI:71983709 GenBank EFP10952.1 445 hypothetical protein CRE_30692 [Caenorhabditis remanei]
GI:71983709 RefSeq XP_002637057.1 428 C. briggsae CBR-DAF-36 protein [Caenorhabditis briggsae]
GI:71983709 RefSeq XP_003105594.1 428 CRE-DAF-36 protein [Caenorhabditis remanei]
GI:71983709 RefSeq XP_003112431.1 445 hypothetical protein CRE_30692 [Caenorhabditis remanei]