Gene/Proteome Database (LMPD)
Proteins
Protein HPO-17 | |
---|---|
Refseq ID | NP_506467 |
Protein GI | 17563076 |
UniProt ID | P92012 |
mRNA ID | NM_074066 |
Length | 179 |
RefSeq Status | REVIEWED |
MSCFVTVGSTLFEDLINQVLCEASLENLKKIGVKKIRLQIGKGNFNQDVIDRVFGETSGDEGSVKCDGLDIDYYRYKPSLSEDMAEALIVIGHGGAGTCLEVLALHLPFITVTNDKLMDNHQAELAVQLSDEGYLLQCTPSTLPETILKENLFSLRQFAAPSKKFVAEHIKQLVGIKNH |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0030246 | IEA:InterPro | F | carbohydrate binding |
GO:0016758 | IEA:InterPro | F | transferase activity, transferring hexosyl groups |
GO:0030259 | IEA:InterPro | P | lipid glycosylation |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR007235 | Glycosyl transferase, family 28, C-terminal |
UniProt Annotations
Entry Information
Identical and Related Proteins
Unique RefSeq proteins for LMP008024 (as displayed in Record Overview)
Identical Sequences to LMP008024 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:17563076 | EMBL | CAB03253.2 | 179 | Protein HPO-17 [Caenorhabditis elegans] |
Related Sequences to LMP008024 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:17563076 | EMBL | CAP30544.1 | 180 | Protein CBR-HPO-17 [Caenorhabditis briggsae] |
GI:17563076 | GenBank | EFO87624.1 | 179 | hypothetical protein CRE_05659 [Caenorhabditis remanei] |
GI:17563076 | GenBank | EGT42419.1 | 181 | hypothetical protein CAEBREN_20186 [Caenorhabditis brenneri] |
GI:17563076 | GenBank | EGT52865.1 | 181 | hypothetical protein CAEBREN_17936 [Caenorhabditis brenneri] |
GI:17563076 | RefSeq | XP_002635180.1 | 180 | Hypothetical protein CBG11418 [Caenorhabditis briggsae] |
GI:17563076 | RefSeq | XP_003110331.1 | 179 | hypothetical protein CRE_05659 [Caenorhabditis remanei] |