Gene/Proteome Database (LMPD)
Proteins
Protein GPDH-1 | |
---|---|
Refseq ID | NP_493454 |
Protein GI | 17507425 |
UniProt ID | Q9XTS4 |
mRNA ID | NM_061053 |
Length | 374 |
RefSeq Status | REVIEWED |
MPCQNFDYSYNFNNNSGEDYRKKIAIVGGGNWGSAIACVVGKTVKAQDEVFQPIVSIWCRDSRKPGDLSPSIAETINSTHENPKYLPGRRIPDNVVATSSLLEACQSAHILILVVPHQGIPQICDELRGKLQKGAHAISLTKGISSSCENGEIKMQLISEDIERALGVQCSVLMGANLAGEVADGKFCEATIGCKSLKNGEELKKVFDTPNFRIRVTTDYEAVELCGALKNIVACAAGFADGLGWAYNVKSAIIRLGLLETKKFVEHFYPSSVGHTYFESCGVADLITTCYGGRNRKVAEAFIKSDKPLRVIEQELLKGQSAQGPPTAQDVYEMLEINEISEKFPIFASVHKVFTGHHGEQELYDSLRNHPEYD |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0009331 | IEA:InterPro | C | glycerol-3-phosphate dehydrogenase complex |
GO:0004368 | ISS:WormBase | F | glycerol-3-phosphate dehydrogenase activity |
GO:0004367 | IEA:InterPro | F | glycerol-3-phosphate dehydrogenase [NAD+] activity |
GO:0051287 | IEA:InterPro | F | NAD binding |
GO:0005975 | IEA:InterPro | P | carbohydrate metabolic process |
GO:0046168 | IEA:InterPro | P | glycerol-3-phosphate catabolic process |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR008927 | 6-phosphogluconate dehydrogenase, C-terminal-like |
IPR013328 | Dehydrogenase, multihelical |
IPR006168 | Glycerol-3-phosphate dehydrogenase, NAD-dependent |
IPR006109 | Glycerol-3-phosphate dehydrogenase, NAD-dependent, C-terminal |
IPR017751 | Glycerol-3-phosphate dehydrogenase, NAD-dependent, eukaryotic |
IPR011128 | Glycerol-3-phosphate dehydrogenase, NAD-dependent, N-terminal |
IPR016040 | NAD(P)-binding domain |
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Catalytic Activity | sn-glycerol 3-phosphate + NAD(+) = glycerone phosphate + NADH. |
Similarity | Belongs to the NAD-dependent glycerol-3-phosphate dehydrogenase family. |
Identical and Related Proteins
Unique RefSeq proteins for LMP008117 (as displayed in Record Overview)
Identical Sequences to LMP008117 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:17507425 | EMBL | CAB16310.1 | 374 | Protein GPDH-1 [Caenorhabditis elegans] |
GI:17507425 | GenBank | ABZ31360.1 | 374 | Sequence 5298 from patent US 7314974 |
Related Sequences to LMP008117 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:17507425 | EMBL | CAP36214.1 | 374 | Protein CBR-GPDH-1 [Caenorhabditis briggsae] |
GI:17507425 | GenBank | EFP03314.1 | 378 | CRE-GPDH-1 protein [Caenorhabditis remanei] |
GI:17507425 | GenBank | EGT32474.1 | 377 | CBN-GPDH-1 protein [Caenorhabditis brenneri] |
GI:17507425 | RefSeq | XP_002646459.1 | 374 | C. briggsae CBR-GPDH-1 protein [Caenorhabditis briggsae] |
GI:17507425 | RefSeq | XP_003113124.1 | 395 | CRE-GPDH-2 protein [Caenorhabditis remanei] |
GI:17507425 | RefSeq | XP_003115179.1 | 378 | CRE-GPDH-1 protein [Caenorhabditis remanei] |