Gene/Proteome Database (LMPD)
Proteins
Protein SDHB-1 | |
---|---|
Refseq ID | NP_495992 |
Protein GI | 17533915 |
UniProt ID | Q09545 |
mRNA ID | NM_063591 |
Length | 298 |
RefSeq Status | REVIEWED |
MLARSARLLHSAELAANAIRAASGAPATAAAAEASFPSTDDVAAKTKKTGNRIKTFEIYRFNPEAPGAKPTVQKFDVDLDQCGTMILDALIKIKNEVDPTLTFRRSCREGICGSCAMNIGGQNTLACICKIDSDTSKSTKIYPLPHMFVVKDLVPDMNLFYAQYASIQPWIQKKTPLTLGEKQMHQSVAERDRLDGLYECILCACCSTSCPSYWWNADKYLGPAVLMQAYRWVIDSRDDYATERLHRMHDSFSAFKCHTIMNCTKTCPKHLNPAKAIGEIKSLLTGFTSKPAAEPSAF |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005743 | ISS:UniProtKB | C | mitochondrial inner membrane |
GO:0005749 | ISS:UniProtKB | C | mitochondrial respiratory chain complex II |
GO:0005739 | IDA:WormBase | C | mitochondrion |
GO:0051537 | ISS:UniProtKB | F | 2 iron, 2 sulfur cluster binding |
GO:0051538 | ISS:UniProtKB | F | 3 iron, 4 sulfur cluster binding |
GO:0051539 | ISS:UniProtKB | F | 4 iron, 4 sulfur cluster binding |
GO:0009055 | IEA:InterPro | F | electron carrier activity |
GO:0046872 | IEA:UniProtKB-KW | F | metal ion binding |
GO:0008177 | IEA:UniProtKB-EC | F | succinate dehydrogenase (ubiquinone) activity |
GO:0048039 | ISS:UniProtKB | F | ubiquinone binding |
GO:0006099 | IEA:UniProtKB-UniPathway | P | tricarboxylic acid cycle |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
cel01200 | Carbon metabolism |
cel00020 | Citrate cycle (TCA cycle) |
cel_M00009 | Citrate cycle (TCA cycle, Krebs cycle) |
cel_M00148 | Succinate dehydrogenase (ubiquinone) |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR006058 | 2Fe-2S ferredoxin, iron-sulphur binding site |
IPR001041 | 2Fe-2S ferredoxin-type domain |
IPR017900 | 4Fe-4S ferredoxin, iron-sulphur binding, conserved site |
IPR017896 | 4Fe-4S ferredoxin-type, iron-sulphur binding domain |
IPR009051 | Alpha-helical ferredoxin |
IPR012675 | Beta-grasp domain |
IPR025192 | Succinate dehydogenase/fumarate reductase N-terminal |
IPR004489 | Succinate dehydrogenase/fumarate reductase iron-sulphur protein |
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Catalytic Activity | Succinate + a quinone = fumarate + a quinol. |
Cofactor | Name=[2Fe-2S] cluster; Xref=ChEBI:CHEBI:49601; Evidence={ECO:0000250}; Note=Binds 1 [2Fe-2S] cluster. {ECO:0000250}; |
Cofactor | Name=[3Fe-4S] cluster; Xref=ChEBI:CHEBI:21137; Evidence={ECO:0000250}; Note=Binds 1 [3Fe-4S] cluster. {ECO:0000250}; |
Cofactor | Name=[4Fe-4S] cluster; Xref=ChEBI:CHEBI:49883; Evidence={ECO:0000250}; Note=Binds 1 [4Fe-4S] cluster. {ECO:0000250}; |
Function | Iron-sulfur protein (IP) subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q). {ECO:0000250}. |
Pathway | Carbohydrate metabolism; tricarboxylic acid cycle; fumarate from succinate (eukaryal route): step 1/1. |
Sequence Caution | Sequence=BAA23717.1; Type=Frameshift; Positions=4, 15, 28; Evidence={ECO:0000305}; |
Similarity | Belongs to the succinate dehydrogenase/fumarate reductase iron-sulfur protein family. {ECO:0000305}. |
Similarity | Contains 1 2Fe-2S ferredoxin-type domain. {ECO:0000255|PROSITE-ProRule:PRU00465}. |
Similarity | Contains 1 4Fe-4S ferredoxin-type domain. {ECO:0000255|PROSITE-ProRule:PRU00711}. |
Subcellular Location | Mitochondrion inner membrane {ECO:0000250}; Peripheral membrane protein {ECO:0000250}; Matrix side {ECO:0000250}. |
Subunit | Component of complex II composed of four subunits: a flavoprotein (FP), an iron-sulfur protein (IP), and a cytochrome b composed of a large and a small subunit. {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP008144 (as displayed in Record Overview)
Identical Sequences to LMP008144 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:17533915 | EMBL | CAA87780.1 | 298 | Protein SDHB-1 [Caenorhabditis elegans] |
GI:17533915 | GenBank | ABZ31578.1 | 298 | Sequence 5516 from patent US 7314974 |
GI:17533915 | SwissProt | Q09545.1 | 298 | RecName: Full=Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial; AltName: Full=Iron-sulfur subunit of complex II; Short=Ip; Flags: Precursor [Caenorhabditis elegans] |
Related Sequences to LMP008144 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:17533915 | DBBJ | BAA23717.1 | 297 | iron-sulfur subunit of mitochondrial succinate dehydrogenase [Caenorhabditis elegans] |
GI:17533915 | EMBL | CAP22357.2 | 282 | Protein CBR-SDHB-1 [Caenorhabditis briggsae] |
GI:17533915 | GenBank | EGT46387.1 | 282 | hypothetical protein CAEBREN_09832 [Caenorhabditis brenneri] |
GI:17533915 | GenBank | EGT51763.1 | 282 | hypothetical protein CAEBREN_03271 [Caenorhabditis brenneri] |
GI:17533915 | RefSeq | XP_002629663.1 | 302 | C. briggsae CBR-SDHB-1 protein [Caenorhabditis briggsae] |
GI:17533915 | SwissProt | A8WPF0.2 | 282 | RecName: Full=Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial; AltName: Full=Iron-sulfur subunit of complex II; Short=Ip; Flags: Precursor [Caenorhabditis briggsae] |