Gene/Proteome Database (LMPD)
Proteins
Protein LYS-7 | |
---|---|
Refseq ID | NP_503972 |
Protein GI | 17557478 |
UniProt ID | O16202 |
mRNA ID | NM_071571 |
Length | 283 |
RefSeq Status | REVIEWED |
MAHKSIVIFSVLAVLCHSASVKVPPIVDSSLPVKFSEVIAEPAPNVPSNLASYAYALDIYVQTTLSQLQCIKQAGYCAVFVRAYNPAGQGSFDTSSCVTIQNAYKAGLGIEIYMTPQPVSNKQGYQQLDEIIQGLTARAITVRAIWIQVTSPTNWPNNANSNINFINSIVSRARQSGLTVGIYTSYYDWNQITTGWSNIGNDVLLWYWNVYSGGVTGETPANFNDFRKFGCWTAPSVKQFAQDETVCGITVNRDVYLAGNVLKAVEEDGKIYAGGFVQGSLKI |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005975 | IEA:InterPro | P | carbohydrate metabolic process |
GO:0050829 | IMP:WormBase | P | defense response to Gram-negative bacterium |
GO:0050830 | IMP:WormBase | P | defense response to Gram-positive bacterium |
GO:0050832 | IMP:WormBase | P | defense response to fungus |
GO:0045087 | IMP:WormBase | P | innate immune response |
Domain Information
UniProt Annotations
Entry Information
Identical and Related Proteins
Unique RefSeq proteins for LMP008266 (as displayed in Record Overview)
Identical Sequences to LMP008266 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:17557478 | EMBL | CCD62480.1 | 283 | Protein LYS-7 [Caenorhabditis elegans] |
Related Sequences to LMP008266 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:17557478 | EMBL | CAP24070.1 | 282 | Protein CBR-LYS-8, partial [Caenorhabditis briggsae] |
GI:17557478 | EMBL | CCD64956.1 | 286 | Protein LYS-8 [Caenorhabditis elegans] |
GI:17557478 | GenBank | EFO91634.1 | 285 | CRE-LYS-8.1 protein [Caenorhabditis remanei] |
GI:17557478 | RefSeq | NP_495083.1 | 286 | Protein LYS-8 [Caenorhabditis elegans] |
GI:17557478 | RefSeq | XP_002630755.1 | 282 | C. briggsae CBR-LYS-8 protein, partial [Caenorhabditis briggsae] |
GI:17557478 | RefSeq | XP_003109125.1 | 285 | CRE-LYS-8.1 protein [Caenorhabditis remanei] |