Gene/Proteome Database (LMPD)
Proteins
Protein LYS-2 | |
---|---|
Refseq ID | NP_505643 |
Protein GI | 17565330 |
UniProt ID | O62416 |
mRNA ID | NM_073242 |
Length | 279 |
RefSeq Status | REVIEWED |
MIKLLVSFTILFVLSSARPQEIDSNQAAIANTEANEAPVIVNNDASMGNAVDFSFPTNVQVMNCLKKAKYQVVFLRGFVPTGNGAFDSNCVGNIRNAYSAGLGIETYMTPQPISSWQGYQQLDLLYNGLNNNGITIRSVWIQVTSPANWPNNPTANVNFINSIISRAQQYGLSVGIYTNQYDWSQITGNSANINSNVMLWYWNVLGGGTSGETKPTFADFRAFGPFKKASVKQYAQVETVCNLVVNRDVYAVGIPAAAPKTEVNMADGEKIVVGGFVGN |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005975 | IEA:InterPro | P | carbohydrate metabolic process |
GO:0050829 | IMP:WormBase | P | defense response to Gram-negative bacterium |
GO:0050830 | IMP:WormBase | P | defense response to Gram-positive bacterium |
GO:0045087 | IMP:WormBase | P | innate immune response |
Domain Information
UniProt Annotations
Entry Information
Identical and Related Proteins
Unique RefSeq proteins for LMP008284 (as displayed in Record Overview)
Identical Sequences to LMP008284 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:17565330 | EMBL | CAA16324.1 | 279 | Protein LYS-2 [Caenorhabditis elegans] |
Related Sequences to LMP008284 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:17565330 | EMBL | CAP29035.1 | 276 | Protein CBR-LYS-2 [Caenorhabditis briggsae] |
GI:17565330 | GenBank | EFP11211.1 | 280 | CRE-LYS-2 protein [Caenorhabditis remanei] |
GI:17565330 | GenBank | EGT55434.1 | 296 | hypothetical protein CAEBREN_00676 [Caenorhabditis brenneri] |
GI:17565330 | GenBank | EGT55582.1 | 276 | CBN-LYS-2 protein [Caenorhabditis brenneri] |
GI:17565330 | RefSeq | XP_002637074.1 | 276 | C. briggsae CBR-LYS-2 protein [Caenorhabditis briggsae] |
GI:17565330 | RefSeq | XP_003112690.1 | 280 | CRE-LYS-2 protein [Caenorhabditis remanei] |