Gene/Proteome Database (LMPD)
Proteins
Protein LPD-9, isoform a | |
---|---|
Refseq ID | NP_001256228 |
Protein GI | 392920397 |
UniProt ID | Q22641 |
mRNA ID | NM_001269299 |
Length | 131 |
RefSeq Status | REVIEWED |
MSGLSHAGRQVARIAVRQASSHSHDSHAVWKEINRLGSEGKWDNVNNMPKMFLFGEAKQETTAAYRAINKDPDFFRQSPYGQYLKIVWRLALLFGIIKAGTVVYDFAVPEEQRLKYKYRNHGHHGHDDAHD |
Protein LPD-9, isoform b | |
---|---|
Refseq ID | NP_001256229 |
Protein GI | 392920399 |
UniProt ID | D5MCR9 |
mRNA ID | NM_001269300 |
Length | 84 |
RefSeq Status | REVIEWED |
MPKMFLFGEAKQETTAAYRAINKDPDFFRQSPYGQYLKIVWRLALLFGIIKAGTVVYDFAVPEEQRLKYKYRNHGHHGHDDAHD |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0019915 | IMP:WormBase | P | lipid storage |
Domain Information
InterPro Annotations
Accession | Description |
---|
UniProt Annotations
Entry Information
Identical and Related Proteins
Unique RefSeq proteins for LMP008285 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
392920397 | RefSeq | NP_001256228 | 131 | Protein LPD-9, isoform a |
392920399 | RefSeq | NP_001256229 | 84 | Protein LPD-9, isoform b |
Identical Sequences to LMP008285 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:392920397 | EMBL | CAA97333.1 | 131 | Protein LPD-9, isoform a [Caenorhabditis elegans] |
GI:392920399 | EMBL | CBL43457.1 | 84 | Protein LPD-9, isoform b [Caenorhabditis elegans] |
Related Sequences to LMP008285 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:392920399 | EMBL | CAA97333.1 | 131 | Protein LPD-9, isoform a [Caenorhabditis elegans] |
GI:392920399 | EMBL | CAP28964.1 | 131 | Protein CBR-LPD-9 [Caenorhabditis briggsae] |
GI:392920397 | EMBL | CAP28964.1 | 131 | Protein CBR-LPD-9 [Caenorhabditis briggsae] |
GI:392920397 | GenBank | EFP07068.1 | 134 | CRE-LPD-9 protein [Caenorhabditis remanei] |
GI:392920399 | GenBank | EGT48546.1 | 131 | CBN-LPD-9 protein [Caenorhabditis brenneri] |
GI:392920397 | GenBank | EGT48546.1 | 131 | CBN-LPD-9 protein [Caenorhabditis brenneri] |
GI:392920399 | GenBank | EGT60121.1 | 131 | hypothetical protein CAEBREN_04464 [Caenorhabditis brenneri] |
GI:392920397 | GenBank | EGT60121.1 | 131 | hypothetical protein CAEBREN_04464 [Caenorhabditis brenneri] |
GI:392920399 | RefSeq | XP_002637145.1 | 131 | C. briggsae CBR-LPD-9 protein [Caenorhabditis briggsae] |
GI:392920397 | RefSeq | XP_002637145.1 | 131 | C. briggsae CBR-LPD-9 protein [Caenorhabditis briggsae] |
GI:392920397 | RefSeq | XP_003101469.1 | 134 | CRE-LPD-9 protein [Caenorhabditis remanei] |
GI:392920399 | RefSeq | NP_001256228.1 | 131 | Protein LPD-9, isoform a [Caenorhabditis elegans] |