Gene/Proteome Database (LMPD)
Proteins
Protein Y49A3A.1 | |
---|---|
Refseq ID | NP_506558 |
Protein GI | 115534720 |
UniProt ID | G5EC25 |
mRNA ID | NM_074157 |
Length | 424 |
RefSeq Status | REVIEWED |
MVTTRSRSKNNRAADKDRSKERYAYRPRSTFEESDALVGFKTIDHYLQYDCLLTREELHRLDEHVYSAVDTSWLDELCMKKFWEAVVLYYPLWVAPNLLTLIGLIVNLTTVLVLSFYCPTATETAPAWAYFLAAFGLFVYQTLDATDGKQARRIGASSPLGELFDHGCDSASQVFVTLNVCYALQLGSVRCGVFIACLISVSLFYTAHWSTYCTGQLRFARFDVTEAQWSIISMLLCTSLFGPKLWSVGIFGYALKHLLLACVGLGTIYQALGYLSVIFTDGVGKNGSTVAGTSVLFPACPLLAVIVPYCMIYSKSASGVYDDLIVIFVLQFGAVAAKATNRLIVAHMSRSELSLWDWIYMGPIALMINQYYDIKINEPTLLKYTTVYVYASLLVYCLFITRQICDHMGIYCFKVTAPRAGSSK |
Gene Information
Entrez Gene ID
Gene Name
Protein Y49A3A.1
Gene Symbol
Species
Caenorhabditis elegans
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0016020 | IEA:InterPro | C | membrane |
GO:0016780 | IEA:InterPro | F | phosphotransferase activity, for other substituted phosphate groups |
GO:0008654 | IEA:InterPro | P | phospholipid biosynthetic process |
Domain Information
UniProt Annotations
Entry Information
Identical and Related Proteins
Unique RefSeq proteins for LMP008296 (as displayed in Record Overview)
Identical Sequences to LMP008296 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:115534720 | EMBL | CAA22073.2 | 424 | Protein CEPT-2 [Caenorhabditis elegans] |
Related Sequences to LMP008296 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:115534720 | EMBL | CAP25301.1 | 424 | Protein CBG04633 [Caenorhabditis briggsae] |
GI:115534720 | EMBL | CDJ90526.1 | 416 | CDP-alcohol phosphatidyltransferase domain containing protein [Haemonchus contortus] |
GI:115534720 | EMBL | CDJ80790.1 | 816 | CDP-alcohol phosphatidyltransferase and Methyltransferase TRM13 domain containing protein [Haemonchus contortus] |
GI:115534720 | GenBank | EFP11114.1 | 437 | hypothetical protein CRE_30928 [Caenorhabditis remanei] |
GI:115534720 | RefSeq | XP_002637842.1 | 424 | Hypothetical protein CBG04633 [Caenorhabditis briggsae] |
GI:115534720 | RefSeq | XP_003112593.1 | 437 | hypothetical protein CRE_30928 [Caenorhabditis remanei] |