Gene/Proteome Database (LMPD)
Proteins
Protein PHG-1 | |
---|---|
Refseq ID | NP_496186 |
Protein GI | 25150480 |
UniProt ID | Q09553 |
mRNA ID | NM_063785 |
Length | 228 |
MRRVILPLVMTVTLCLAQEASEACTKALTDCENDLECQNRLAPLMAACSTNTCQPQCRSAVLNVYQNKLGRILLRSDATCIPGRDELRTCNFLPAESTVHCSLGKLACEGDLQCNSKFGVFMSECEADAARGACTDKCKTLLNQTIETSVGSVFSNCTCTARDDQLCTNLKDNLLGVCLKNTPGVTLSPSDNSITDAPGGNDLADSSVGHGFNILSAISVYLLTVLVF |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0046658 | IDA:UniProtKB | C | anchored component of plasma membrane |
GO:0007275 | IMP:UniProtKB | P | multicellular organismal development |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR016017 | GDNF/GAS1 |
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Developmental Stage | All developmental stages, but not dauer larva |
Developmental Stage | All developmental stages, but not dauer larva. {ECO:0000269|PubMed:11955608}. |
Function | Role in pharynx function or development |
Function | Role in pharynx function or development. {ECO:0000269|PubMed:11955608}. |
Subcellular Location | Cell membrane ; Lipid-anchor, GPI-anchor . Note=Localized on the muscle cell plasma membrane. |
Subcellular Location | Cell membrane {ECO:0000269|PubMed:11955608}; Lipid-anchor, GPI-anchor {ECO:0000269|PubMed:11955608}. Note=Localized on the muscle cell plasma membrane. |
Tissue Specificity | Pharynx muscle cells from its early formation, in the two-fold embryo, until the adult stage |
Tissue Specificity | Pharynx muscle cells from its early formation, in the two-fold embryo, until the adult stage. {ECO:0000269|PubMed:11955608}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP008367 (as displayed in Record Overview)
Identical Sequences to LMP008367 proteins
Reference | Database | Accession | Length | Protein Name |
---|
Related Sequences to LMP008367 proteins
Reference | Database | Accession | Length | Protein Name |
---|