Gene/Proteome Database (LMPD)

LMPD ID
LMP008892
Gene ID
Species
Drosophila melanogaster (Drosophila)
Gene Name
lethal (2) k12914
Gene Symbol
Synonyms
BcDNA:RE23864; CG13393; Dmel\CG13393
Alternate Names
CG13393-PA; l(2)k12914-PA; lethal (2) k12914
Chromosome
2L
Map Location
29C1-29B4
EC Number
2.4.99.18

Proteins

lethal (2) k12914
Refseq ID NP_609222
Protein GI 20129377
UniProt ID Q9VLM5
mRNA ID NM_135378
Length 112
RefSeq Status REVIEWED
MVELSSVISKFYNDYVQNTPKKLKLVDIYLGYILLTGIIQFVYCCLVGTFPFNSFLSGFISTVSCFVLAVCLRLQANPQNKSVFAGISPERGFADFIFAHVILHLVVMNFIG

Gene Information

Entrez Gene ID
Gene Name
lethal (2) k12914
Gene Symbol
Species
Drosophila melanogaster

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0008250 IEA:InterPro C oligosaccharyltransferase complex
GO:0004579 IEA:InterPro F dolichyl-diphosphooligosaccharide-protein glycotransferase activity
GO:0006915 IEA:UniProtKB-KW P apoptotic process
GO:0006486 IEA:UniProtKB-UniPathway P protein glycosylation

KEGG Pathway Links

KEGG Pathway ID Description
dme00510 N-Glycan biosynthesis
dme_M00072 N-glycosylation by oligosaccharyltransferase
dme04141 Protein processing in endoplasmic reticulum
ko04141 Protein processing in endoplasmic reticulum

Domain Information

InterPro Annotations

Accession Description
IPR003038 DAD/Ost2

UniProt Annotations

Entry Information

Gene Name
lethal (2) k12914
Protein Entry
DAD1_DROME
UniProt ID
Species
Drosophila

Comments

Comment Type Description
Catalytic Activity Dolichyl diphosphooligosaccharide + [protein]- L-asparagine = dolichyl diphosphate + a glycoprotein with the oligosaccharide chain attached by N-beta-D-glycosyl linkage to a protein L-asparagine.
Function Essential subunit of the N-oligosaccharyl transferase (OST) complex which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. Possesses cell death-inhibiting activity. {ECO:0000250}.
Pathway Protein modification; protein glycosylation.
Similarity Belongs to the DAD/OST2 family. {ECO:0000305}.
Subcellular Location Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}.
Subunit Component of the oligosaccharyltransferase (OST) complex. {ECO:0000250}.

Identical and Related Proteins

Unique RefSeq proteins for LMP008892 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
20129377 RefSeq NP_609222 112 lethal (2) k12914

Identical Sequences to LMP008892 proteins

Reference Database Accession Length Protein Name
GI:20129377 GenBank ACL86632.1 112 CG13393-PA, partial [synthetic construct]
GI:20129377 GenBank ACL91249.1 112 CG13393-PA [synthetic construct]
GI:20129377 RefSeq XP_001970296.1 112 GG23447 [Drosophila erecta]
GI:20129377 RefSeq XP_002036211.1 112 GM12988 [Drosophila sechellia]
GI:20129377 RefSeq XP_002088798.1 112 GE11027 [Drosophila yakuba]
GI:20129377 RefSeq XP_002078649.1 112 GD22410 [Drosophila simulans]

Related Sequences to LMP008892 proteins

Reference Database Accession Length Protein Name
GI:20129377 GenBank EDV31169.1 112 GF14682 [Drosophila ananassae]
GI:20129377 GenBank EDW57634.1 112 GJ18193 [Drosophila virilis]
GI:20129377 GenBank EDW78146.1 112 GK24842 [Drosophila willistoni]
GI:20129377 RefSeq XP_001961948.1 112 GF14682 [Drosophila ananassae]
GI:20129377 RefSeq XP_002057561.1 112 GJ18193 [Drosophila virilis]
GI:20129377 RefSeq XP_002067160.1 112 GK24842 [Drosophila willistoni]