Gene/Proteome Database (LMPD)

LMPD ID
LMP008938
Gene ID
41709
Species
Drosophila melanogaster (Drosophila)
Gene Name
forkhead box, sub-group O
Gene Symbol
foxo
Synonyms
3143; Afx; anon-WO0118547.374; cg3143; CG3143; dfoxo; dFoxo; dFoxO; dFOXO; Dfoxo; Dmel\CG3143; DmQ95V5; fd88A; FKHR; foxO; Foxo; FoxO; FOXO; foxo|dFOXO; Q95V55
Chromosome
3R
Map Location
88A5-88A8

Proteins

forkhead box, sub-group O, isoform B
Refseq ID NP_996205
Protein GI 45553355
UniProt ID Q95V55
mRNA ID NM_206483
Length 613
RefSeq Status REVIEWED
Protein sequence is identical to GI:45553353 (mRNA isoform)
forkhead box, sub-group O, isoform C
Refseq ID NP_996204
Protein GI 45553353
UniProt ID Q95V55
mRNA ID NM_206482
Length 613
RefSeq Status REVIEWED
MMDGYAQEWPRLTHTDNGLAMDQLGGDLPLDVGFEPQTRARSNTWPCPRPENFVEPTDELDSTKASNQQLAPGDSQQAIQNANAAKKNSSRRNAWGNLSYADLITHAIGSATDKRLTLSQIYEWMVQNVPYFKDKGDSNSSAGWKNSIRHNLSLHNRFMRVQNEGTGKSSWWMLNPEAKPGKSVRRRAASMETSRYEKRRGRAKKRVEALRQAGVVGLNDATPSPSSSVSEGLDHFPESPLHSGGGFQLSPDFRQRASSNASSCGRLSPIRAQDLEPDWGFPVDYQNTTMTQAHAQALEELTGTMADELTLCNNGFSAASGLPSQPPPPPYQPPQHQQANQQQSPYALNGPASGYNTLQPQSQCLLHRSLNCSCMHNARDGLSPNSVTTTMSPAYPNSEPSSDSLNTYSNVVLDGPADTAALMVNNQQQLSASLEGQCLEVLNNEAQPIDEFNLENFPVGNLECNVEELLQQEMSYGGLLDINIPLATVNTNLVNSSSGPLSISNISNLSNISSNSGSSLSLNQLQAQLNNANQANQQHQQHQQQLLLNNNNNSSSSLELATQTATTNLNARVQYSQPSVVTSPPSWVH
forkhead box, sub-group O, isoform F
Refseq ID NP_650330
Protein GI 386765716
UniProt ID Q95V55
mRNA ID NM_142073
Length 622
RefSeq Status REVIEWED
Protein sequence is identical to GI:442619011 (mRNA isoform)
forkhead box, sub-group O, isoform G
Refseq ID NP_001262557
Protein GI 442619011
UniProt ID Q95V55
mRNA ID NM_001275628
Length 622
RefSeq Status REVIEWED
MMDGYAQEWPRLTHTDNGLAMDQLGGDLPLDVGFEPQTRARSNTWPCPRPENFVEPTDELDSTKASNQQLAPGDSQQAIQNANAAKKNSSRRNAWGNLSYADLITHAIGSATDKRLTLSQIYEWMVQNVPYFKDKGDSNSSAGWKNSIRHNLSLHNRFMRVQNEGTGKSSWWMLNPEAKPGKSVRRRAASMETSRYEKRRGRAKKRVEALRQAGVVGLNDATPSPSSSVSEGLDHFPESPLHSGGGFQLSPDFRQRASSNASSCGRLSPIRAQDLEPDWGFPVDYQNTTMTQAHAQALEELTGTMADELTLCNNGFSAASGLPSQPPPPPYQPPQHQQANQQQSPYALNGPASGYNTLQPQSQCLLHRSLNCSCMHNARDGLSPNSVTTTMSPAYPNSEPSSDSLNTYSNVVLDGPADTAALMVNNQQQLSASLEDNNCASTLIGQCLEVLNNEAQPIDEFNLENFPVGNLECNVEELLQQEMSYGGLLDINIPLATVNTNLVNSSSGPLSISNISNLSNISSNSGSSLSLNQLQAQLNNANQANQQHQQHQQQLLLNNNNNSSSSLELATQTATTNLNARVQYSQPSVVTSPPSWVH

Gene Information

Entrez Gene ID
41709
Gene Name
forkhead box, sub-group O
Gene Symbol
foxo
Species
Drosophila melanogaster

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IDA:UniProtKB C cytoplasm
GO:0005829 TAS:Reactome C cytosol
GO:0005634 IDA:UniProtKB C nucleus
GO:0003677 IDA:FlyBase F DNA binding
GO:0001077 IDA:FlyBase F RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription
GO:0043565 IDA:FlyBase F sequence-specific DNA binding
GO:0003700 IMP:UniProtKB F sequence-specific DNA binding transcription factor activity
GO:0006171 IDA:FlyBase P cAMP biosynthetic process
GO:0007049 IEA:UniProtKB-KW P cell cycle
GO:0006974 IMP:FlyBase P cellular response to DNA damage stimulus
GO:0034198 IDA:FlyBase P cellular response to amino acid starvation
GO:0034599 IMP:FlyBase P cellular response to oxidative stress
GO:0009267 IMP:FlyBase P cellular response to starvation
GO:0007623 IMP:FlyBase P circadian rhythm
GO:0001745 IMP:FlyBase P compound eye morphogenesis
GO:0048813 IMP:FlyBase P dendrite morphogenesis
GO:0008340 IMP:FlyBase P determination of adult lifespan
GO:0036099 IMP:FlyBase P female germ-line stem cell maintenance
GO:0042593 IMP:UniProtKB P glucose homeostasis
GO:0005977 IMP:FlyBase P glycogen metabolic process
GO:0007476 IMP:FlyBase P imaginal disc-derived wing morphogenesis
GO:0008286 IGI:FlyBase P insulin receptor signaling pathway
GO:0045475 IGI:FlyBase P locomotor rhythm
GO:0001578 IDA:FlyBase P microtubule bundle formation
GO:0010259 IMP:UniProtKB P multicellular organismal aging
GO:0007520 IMP:FlyBase P myoblast fusion
GO:0030308 IMP:UniProtKB P negative regulation of cell growth
GO:0008285 IMP:UniProtKB P negative regulation of cell proliferation
GO:0045792 IMP:FlyBase P negative regulation of cell size
GO:0046627 IMP:UniProtKB P negative regulation of insulin receptor signaling pathway
GO:0010888 IDA:FlyBase P negative regulation of lipid storage
GO:0040015 IMP:FlyBase P negative regulation of multicellular organism growth
GO:1900078 IGI:FlyBase P positive regulation of cellular response to insulin stimulus
GO:2000253 IMP:FlyBase P positive regulation of feeding behavior
GO:2000130 IMP:FlyBase P positive regulation of octopamine signaling pathway
GO:0045944 IDA:FlyBase P positive regulation of transcription from RNA polymerase II promoter
GO:0045893 IDA:FlyBase P positive regulation of transcription, DNA-templated
GO:0010506 IMP:FlyBase P regulation of autophagy
GO:0001558 IMP:FlyBase P regulation of cell growth
GO:0040008 IGI:FlyBase P regulation of growth
GO:0035206 IMP:FlyBase P regulation of hemocyte proliferation
GO:0046626 IGI:FlyBase P regulation of insulin receptor signaling pathway
GO:0019216 IMP:UniProtKB P regulation of lipid metabolic process
GO:0016241 IMP:FlyBase P regulation of macroautophagy
GO:0006355 IMP:UniProtKB P regulation of transcription, DNA-templated
GO:0009617 IDA:FlyBase P response to bacterium
GO:0006979 IMP:FlyBase P response to oxidative stress
GO:0007525 IMP:FlyBase P somatic muscle development

REACTOME Pathway Links

REACTOME Pathway ID Description
6226504 AKT phosphorylates targets in the nucleus
6226560 AKT-mediated inactivation of FOXO1A
6226008 Adaptive Immune System
6226970 Constitutive PI3K/AKT Signaling in Cancer
6226001 DAP12 interactions
6226000 DAP12 signaling
6226115 Developmental Biology
6225885 Disease
6225989 Downstream signal transduction
6226491 Downstream signaling events of B Cell Receptor (BCR)
6225992 Downstream signaling of activated FGFR
6226010 Fc epsilon receptor (FCERI) signaling
6226381 GAB1 signalosome
6226003 Immune System
6226002 Innate Immune System
6225987 NGF signalling via TRKA from the plasma membrane
6226382 PI-3K cascade
6226493 PI3K events in ERBB2 signaling
6226492 PI3K events in ERBB4 signaling
6226494 PI3K/AKT Signaling in Cancer
6226486 PI3K/AKT activation
6226490 PIP3 activates AKT signaling
6226557 Regulation of beta-cell development
6226561 Regulation of gene expression in beta cells
6226495 Role of LAT2/NTAL/LAB on calcium mobilization
6225975 Signal Transduction
6225996 Signaling by EGFR
6225997 Signaling by EGFR in Cancer
6225999 Signaling by ERBB2
6226122 Signaling by ERBB4
6225993 Signaling by FGFR
6225994 Signaling by FGFR in disease
6226313 Signaling by NODAL
6225990 Signaling by PDGF
6226123 Signaling by SCF-KIT
6226007 Signaling by the B Cell Receptor (BCR)
6225988 Signalling by NGF

Domain Information

InterPro Annotations

Accession Description
IPR001766 TF_fork_head
IPR018122 TF_fork_head_CS
IPR011991 Winged helix-turn-helix DNA-binding domain

UniProt Annotations

Entry Information

Gene Name
forkhead box, sub-group O
Protein Entry
Q95V55_DROME
UniProt ID
Q95V55
Species
Drosophila

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=4; Name=B {ECO:0000269|PubMed:12893776}; Synonyms=C {ECO:0000269|PubMed:10731132}; IsoId=Q95V55-1; Sequence=Displayed; Name=A {ECO:0000269|PubMed:10731132}; IsoId=Q95V55-2; Sequence=VSP_053041; Note=No experimental confirmation available. {ECO:0000305}; Name=D {ECO:0000269|PubMed:10731132}; IsoId=Q95V55-3; Sequence=VSP_053040, VSP_053042; Note=No experimental confirmation available. {ECO:0000305}; Name=E {ECO:0000269|Ref.2}; IsoId=Q95V55-4; Sequence=VSP_053039, VSP_053043;
Disruption Phenotype Mutant foxo lacking Akt1 phosphorylation sites no longer responds to insulin inhibition, remains in the nucleus, and is constitutively active, inducing cell arrest. {ECO:0000269|PubMed:12893776}.
Function Transcription factor involved in the regulation of the insulin signaling pathway. Consistently activates both the downstream target Thord4EBP and the feedback control target InR. Involved in negative regulation of the cell cycle, modulating cell growth and proliferation. In response to cellular stresses, such as nutrient deprivation or increased levels of reactive oxygen species, foxo is activated and inhibits growth through the action of target genes such as Thor. Foxo activated in the adult fat body can regulate lifespan in adults; an insulin peptide itself may function as one secondary messenger of insulin-regulated aging. Also regulates Lip4, homolog of human acid lipases, thereby acting as a key modulator of lipid metabolism by insulin signaling and integrates insulin responses to glucose and lipid homeostasis. {ECO:0000269|PubMed:12893776, ECO:0000269|PubMed:12908874, ECO:0000269|PubMed:15175753, ECO:0000269|PubMed:16054033, ECO:0000269|PubMed:18234213}.
Interaction Q8I9J6:HDAC4; NbExp=3; IntAct=EBI-500849, EBI-4288282;
Sequence Caution Sequence=AAL13947.1; Type=Erroneous initiation; Evidence={ECO:0000305};
Similarity Contains 1 fork-head DNA-binding domain. {ECO:0000255|PROSITE-ProRule:PRU00089}.
Subcellular Location Cytoplasm {ECO:0000269|PubMed:12893776, ECO:0000269|PubMed:15175753}. Nucleus {ECO:0000255|PROSITE- ProRule:PRU00089, ECO:0000269|PubMed:12893776, ECO:0000269|PubMed:15175753}. Note=When phosphorylated, translocated from nucleus to cytoplasm. Dephosphorylation triggers nuclear translocation. {ECO:0000269|PubMed:12893776, ECO:0000269|PubMed:15175753}.
Subunit Interacts with melt. {ECO:0000269|PubMed:16054033}.

Identical and Related Proteins

Unique RefSeq proteins for LMP008938 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
45553353 RefSeq NP_996204 613 forkhead box, sub-group O, isoform C
442619011 RefSeq NP_001262557 622 forkhead box, sub-group O, isoform G

Identical Sequences to LMP008938 proteins

Reference Database Accession Length Protein Name
GI:45553353 GenBank AAL28078.1 613 AFX [Drosophila melanogaster]
GI:45553353 GenBank AAL90280.1 613 LD19191p [Drosophila melanogaster]
GI:45553353 gnl FlyBase 613 forkhead box, sub-group O, isoform B [Drosophila melanogaster]
GI:45553353 gnl FlyBase 613 forkhead box, sub-group O, isoform C [Drosophila melanogaster]
GI:442619011 gnl FlyBase 622 forkhead box, sub-group O, isoform F [Drosophila melanogaster]
GI:442619011 gnl FlyBase 622 forkhead box, sub-group O, isoform G [Drosophila melanogaster]
GI:45553353 RefSeq NP_996205.1 613 forkhead box, sub-group O, isoform B [Drosophila melanogaster]
GI:442619011 RefSeq NP_650330.3 622 forkhead box, sub-group O, isoform F [Drosophila melanogaster]
GI:45553353 SwissProt Q95V55.1 613 RecName: Full=Forkhead box protein O; Short=dFOXO; AltName: Full=Protein FKHR [Drosophila melanogaster]

Related Sequences to LMP008938 proteins

Reference Database Accession Length Protein Name
GI:442619011 GenBank AAL28078.1 613 AFX [Drosophila melanogaster]
GI:442619011 GenBank AAL90280.1 613 LD19191p [Drosophila melanogaster]
GI:442619011 gnl FlyBase 613 forkhead box, sub-group O, isoform B [Drosophila melanogaster]
GI:442619011 gnl FlyBase 613 forkhead box, sub-group O, isoform C [Drosophila melanogaster]
GI:45553353 gnl FlyBase 622 forkhead box, sub-group O, isoform F [Drosophila melanogaster]
GI:45553353 gnl FlyBase 622 forkhead box, sub-group O, isoform G [Drosophila melanogaster]
GI:442619011 RefSeq NP_996204.1 613 forkhead box, sub-group O, isoform C [Drosophila melanogaster]
GI:442619011 RefSeq NP_996205.1 613 forkhead box, sub-group O, isoform B [Drosophila melanogaster]
GI:45553353 RefSeq NP_650330.3 622 forkhead box, sub-group O, isoform F [Drosophila melanogaster]
GI:45553353 RefSeq NP_001262557.1 622 forkhead box, sub-group O, isoform G [Drosophila melanogaster]
GI:45553353 SwissProt B4PTD3.2 628 RecName: Full=Forkhead box protein O [Drosophila yakuba]
GI:45553353 SwissProt B4HF64.2 609 RecName: Full=Forkhead box protein O [Drosophila sechellia]