Gene/Proteome Database (LMPD)
LMPD ID
LMP008940
Gene ID
Species
Drosophila melanogaster (Drosophila)
Gene Name
G protein alpha q subunit
Gene Symbol
Synonyms
CG17759; dGaalpha; DGalphaq; DGalpha[[q]]; dgq; dGq; Dgq; DGq; dGqa-49b; dgqalpha; dGqalpha; DGqalpha; dGqalpha-3; dGqalpha-49b; dG[[alphaq]]; dG[[q]]alpha; Dmel\CG17759; DmGalpha[[q]]; Dromel_CG17759_galpha49b_mORF; G alpha 49B; G?q; Galpha; galpha49B; Galpha49b; Galpha49B; Galpha[[q]]; Gaq; Gq; Gqa-3; Gqalpha; Gqalphae; Gqalpha[[e]]; Gqalpha{e}; G[q]; G[[alphaq]]; G[[a]]q; G[[qalpha]]; G[[q]]; G[[q]]alpha; sast
Chromosome
2R
Map Location
49B8-49B9
Proteins
G protein alpha q subunit, isoform A | |
---|---|
Refseq ID | NP_725191 |
Protein GI | 24653107 |
UniProt ID | P23625 |
mRNA ID | NM_165919 |
Length | 353 |
RefSeq Status | REVIEWED |
MECCLSEEAKEQKRINQEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGYIKLVFQNIFMAMQSMIKAMDMLKISYGQGEHSELADLVMSIDYETVTTFEDPYLNAIKTLWDDAGIQECYDRRREYQLTDSAKYYLKDLDRVAQPAYLPTEQDILRVRVPTTGIIEYPFDLEEIRFRMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQRDAITAREFILRMFVDLNPDSEKIIYSHFTCATDTENIRFVFAAVKDTILQSNLKEYNLV |
G protein alpha q subunit, isoform C | |
---|---|
Refseq ID | NP_725193 |
Protein GI | 24653111 |
UniProt ID | P23625 |
mRNA ID | NM_165921 |
Length | 353 |
RefSeq Status | REVIEWED |
Protein sequence is identical to GI:24653107 (mRNA isoform) |
G protein alpha q subunit, isoform D | |
---|---|
Refseq ID | NP_725196 |
Protein GI | 24653117 |
UniProt ID | P23625 |
mRNA ID | NM_165924 |
Length | 353 |
RefSeq Status | REVIEWED |
MECCLSEEAKEQKRINQEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGYIKLVFQNIFMAMQSMIKAMDMLKISYGQGEHSELADLVMSIDYETVTTFEDPYLNAIKTLWDDAGIQECYDRRREYQLTDSAKYYLSDLARIEQADYLPTEQDILRARVPTTGILEYPFDLDGIVFRMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPKQDHAAAKQFVLKKYLACNPDPERQCYSHFTTATDTENIKLVFCAVKDTIMQNALKEFNLG |
G protein alpha q subunit, isoform E | |
---|---|
Refseq ID | NP_725194 |
Protein GI | 24653113 |
UniProt ID | P23625 |
mRNA ID | NM_165922 |
Length | 353 |
RefSeq Status | REVIEWED |
Protein sequence is identical to GI:24653107 (mRNA isoform) |
G protein alpha q subunit, isoform G | |
---|---|
Refseq ID | NP_725195 |
Protein GI | 24653115 |
UniProt ID | P23625 |
mRNA ID | NM_165923 |
Length | 353 |
RefSeq Status | REVIEWED |
Protein sequence is identical to GI:24653107 (mRNA isoform) |
G protein alpha q subunit, isoform J | |
---|---|
Refseq ID | NP_725192 |
Protein GI | 442623465 |
UniProt ID | P23625 |
mRNA ID | NM_165920 |
Length | 396 |
RefSeq Status | REVIEWED |
MECCLSEEAKEQKRINQEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGYIKLVFQNIFMAMQSMIKAMDMLKISYGQGEHSELADLVMSIDYETVTTFEDPYLNAIKTLWDDAGIQECYDRRREYQLTDSAKYYLKDLDRVAQPAYLPTEQDILRVRVPTTGIIEYPFDLEEIRFSYLSDLARIEQADYLPTEQDILRARVPTTGILEYPFDLDGIVFRMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQRDAITAREFILRMFVDLNPDSEKIIYSHFTCATDTENIKLVFCAVKDTIMQNALKEFNLG |
Gene Information
Entrez Gene ID
Gene Name
G protein alpha q subunit
Gene Symbol
Species
Drosophila melanogaster
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005834 | ISS:FlyBase | C | heterotrimeric G-protein complex |
GO:0016027 | IDA:FlyBase | C | inaD signaling complex |
GO:0005886 | IDA:FlyBase | C | plasma membrane |
GO:0016028 | IDA:FlyBase | C | rhabdomere |
GO:0031683 | IBA:RefGenome | F | G-protein beta/gamma-subunit complex binding |
GO:0001664 | IBA:RefGenome | F | G-protein coupled receptor binding |
GO:0005525 | IEA:UniProtKB-KW | F | GTP binding |
GO:0003924 | IMP:FlyBase | F | GTPase activity |
GO:0046872 | IEA:UniProtKB-KW | F | metal ion binding |
GO:0004871 | IBA:RefGenome | F | signal transducer activity |
GO:0007202 | IGI:FlyBase | P | activation of phospholipase C activity |
GO:0007188 | IBA:RefGenome | P | adenylate cyclase-modulating G-protein coupled receptor signaling pathway |
GO:0016199 | IMP:FlyBase | P | axon midline choice point recognition |
GO:0071244 | IMP:FlyBase | P | cellular response to carbon dioxide |
GO:0006897 | IMP:FlyBase | P | endocytosis |
GO:0007629 | IGI:FlyBase | P | flight behavior |
GO:0016060 | IMP:FlyBase | P | metarhodopsin inactivation |
GO:0002385 | IMP:FlyBase | P | mucosal immune response |
GO:0046673 | IMP:FlyBase | P | negative regulation of compound eye retinal cell programmed cell death |
GO:0060158 | IBA:RefGenome | P | phospholipase C-activating dopamine receptor signaling pathway |
GO:0007602 | IDA:FlyBase | P | phototransduction |
GO:0016056 | IMP:FlyBase | P | rhodopsin mediated signaling pathway |
GO:0007608 | IMP:FlyBase | P | sensory perception of smell |
GO:0030322 | IGI:FlyBase | P | stabilization of membrane potential |
GO:0043052 | IDA:FlyBase | P | thermotaxis |
GO:0007601 | IEA:UniProtKB-KW | P | visual perception |
KEGG Pathway Links
REACTOME Pathway Links
REACTOME Pathway ID | Description |
---|---|
6226707 | ADP signalling through P2Y purinoceptor 1 |
6226662 | Acetylcholine regulates insulin secretion |
6226663 | Fatty Acids bound to GPR40 (FFAR1) regulate insulin secretion |
6226664 | Free fatty acids regulate insulin secretion |
6226204 | G alpha (q) signalling events |
6226200 | GPCR downstream signaling |
6226119 | Gastrin-CREB signalling pathway via PKC and MAPK |
6226203 | Hemostasis |
6226181 | Integration of energy metabolism |
6225882 | Metabolism |
6226202 | Platelet activation, signaling and aggregation |
6226261 | Regulation of insulin secretion |
6225975 | Signal Transduction |
6226708 | Signal amplification |
6225984 | Signaling by GPCR |
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Alternative Products | Event=Alternative splicing; Named isoforms=2; Comment=Additional isoforms seem to exist.; Name=D; Synonyms=F; IsoId=P23625-1; Sequence=Displayed; Name=A; Synonyms=B, C, E, G, H; IsoId=P23625-2; Sequence=VSP_001835, VSP_001836; |
Function | Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. Could be the transducin analog, an amplifier and one of the transducers of a visual impulse that performs the coupling between opsin and cGMP-phosphodiesterase. Could mediate a subset of olfactory and gustatory responses. {ECO:0000269|PubMed:2125225, ECO:0000269|PubMed:8524786}. |
Similarity | Belongs to the G-alpha family. G(q) subfamily. {ECO:0000305}. |
Tissue Specificity | Isoform D is expressed only in the retina and ocellus of the adult head. Isoform A is expressed in chemosensory cells of the olfactory and taste structures, including a subset of olfactory and gustatory neurons, and in cells of the central nervous system, including neurons in the lamina ganglionaris. {ECO:0000269|PubMed:2125225, ECO:0000269|PubMed:8524786}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP008940 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
24653107 | RefSeq | NP_725191 | 353 | G protein alpha q subunit, isoform A |
24653117 | RefSeq | NP_725196 | 353 | G protein alpha q subunit, isoform D |
442623465 | RefSeq | NP_725192 | 396 | G protein alpha q subunit, isoform J |
Identical Sequences to LMP008940 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:24653117 | GenBank | AAA28460.1 | 353 | retinal specific G-alpha protein [Drosophila melanogaster] |
GI:24653117 | GenBank | ABC86331.1 | 353 | IP15229p [Drosophila melanogaster] |
GI:24653117 | GenBank | ABH96449.1 | 353 | Sequence 12 from patent US 7067277 |
GI:24653107 | GenBank | ABH96450.1 | 353 | Sequence 13 from patent US 7067277 |
GI:24653107 | GenBank | ACL84308.1 | 353 | Galpha49B-PA, partial [synthetic construct] |
GI:24653117 | gnl | FlyBase | 353 | G protein alpha q subunit, isoform D [Drosophila melanogaster] |
GI:24653107 | gnl | FlyBase | 353 | G protein alpha q subunit, isoform K [Drosophila melanogaster] |
GI:442623465 | gnl | FlyBase | 396 | G protein alpha q subunit, isoform J [Drosophila melanogaster] |
GI:24653107 | RefSeq | NP_725194.1 | 353 | G protein alpha q subunit, isoform E [Drosophila melanogaster] |
GI:24653107 | RefSeq | NP_725195.1 | 353 | G protein alpha q subunit, isoform G [Drosophila melanogaster] |
GI:24653107 | RefSeq | NP_725197.2 | 353 | G protein alpha q subunit, isoform K [Drosophila melanogaster] |
GI:24653117 | SwissProt | P23625.2 | 353 | RecName: Full=G protein alpha q subunit; AltName: Full=Guanine nucleotide-binding protein G(q) subunit alpha; AltName: Full=Guanine nucleotide-binding protein alpha-q; AltName: Full=dGQalpha [Drosophila melanogaster] |
Related Sequences to LMP008940 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:24653117 | EMBL | CAB76453.1 | 353 | guanine nucleotide-binding protein alpha subunit [Calliphora vicina] |
GI:24653107 | GenBank | ABH96461.1 | 353 | Sequence 41 from patent US 7067277 |
GI:442623465 | GenBank | EDV56284.1 | 432 | GG20320 [Drosophila erecta] |
GI:24653107 | GenBank | EDW00991.1 | 353 | GH21190 [Drosophila grimshawi] |
GI:24653107 | GenBank | EDW09380.1 | 353 | GI20476 [Drosophila mojavensis] |
GI:442623465 | GenBank | EDW90737.1 | 432 | GE12481 [Drosophila yakuba] |
GI:442623465 | GenBank | EDX06804.1 | 432 | GD10904 [Drosophila simulans] |
GI:24653107 | GenBank | ENO01765.1 | 353 | GA14650, isoform B [Drosophila pseudoobscura pseudoobscura] |
GI:24653117 | GenBank | ENO01766.1 | 353 | GA14650, isoform D [Drosophila pseudoobscura pseudoobscura] |
GI:24653117 | GenBank | JAC47796.1 | 353 | Guanine nucleotide-binding protein G(q) subunit alpha [Bactrocera dorsalis] |
GI:24653117 | GenBank | JAC47797.1 | 353 | Guanine nucleotide-binding protein G(q) subunit alpha [Bactrocera dorsalis] |
GI:442623465 | RefSeq | XP_001975884.1 | 432 | GG20320 [Drosophila erecta] |
GI:24653107 | RefSeq | XP_002005445.1 | 353 | GI20476 [Drosophila mojavensis] |
GI:442623465 | RefSeq | XP_002091025.1 | 432 | GE12481 [Drosophila yakuba] |
GI:442623465 | RefSeq | XP_002081219.1 | 432 | GD10904 [Drosophila simulans] |
GI:24653107 | RefSeq | XP_004444352.1 | 353 | GA14650, isoform B [Drosophila pseudoobscura pseudoobscura] |
GI:24653117 | RefSeq | XP_004444353.1 | 353 | GA14650, isoform D [Drosophila pseudoobscura pseudoobscura] |
GI:24653117 | RefSeq | XP_005180085.1 | 353 | PREDICTED: guanine nucleotide-binding protein G(q) subunit alpha-like isoform X4 [Musca domestica] |