Gene/Proteome Database (LMPD)
Proteins
| halo | |
|---|---|
| Refseq ID | NP_001137765 |
| Protein GI | 221330607 |
| UniProt ID | B7YZU6 |
| mRNA ID | NM_001144293 |
| Length | 109 |
| RefSeq Status | REVIEWED |
| MAELLFPQLERPLPSLPSLHYTLFAYREELRRRDAPFMKMSTIKLHLTDNLILQTIKNIRQYDTIEIMNLNQEINFKRRLTKQMRKVRKLEKLGLHIDPRKLNEDGKWH | |
Gene Information
Entrez Gene ID
Gene Name
CG7428 gene product from transcript CG7428-RB
Gene Symbol
Species
Drosophila melanogaster
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0031887 | IMP:FlyBase | P | lipid particle transport along microtubule |
| GO:0006869 | IMP:FlyBase | P | lipid transport |
| GO:0007018 | IMP:FlyBase | P | microtubule-based movement |
| GO:0032879 | IMP:FlyBase | P | regulation of localization |
| GO:0042325 | IGI:FlyBase | P | regulation of phosphorylation |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR007970 | DUF733 |
UniProt Annotations
Entry Information
Gene Name
CG7428 gene product from transcript CG7428-RB
Protein Entry
B7YZU6_DROME
UniProt ID
Species
Drosophila
Identical and Related Proteins
Unique RefSeq proteins for LMP008966 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 221330607 | RefSeq | NP_001137765 | 109 | halo |
Identical Sequences to LMP008966 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:221330607 | gnl | FlyBase | 109 | halo [Drosophila melanogaster] |
Related Sequences to LMP008966 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:221330607 | GenBank | EDV57357.1 | 109 | GG24588 [Drosophila erecta] |
| GI:221330607 | GenBank | EDW45527.1 | 109 | GM16605 [Drosophila sechellia] |
| GI:221330607 | GenBank | EDX03347.1 | 109 | GD22905 [Drosophila simulans] |
| GI:221330607 | GenBank | AEC46870.1 | 126 | LD43384p, partial [Drosophila melanogaster] |
| GI:221330607 | RefSeq | XP_002041711.1 | 109 | GM16605 [Drosophila sechellia] |
| GI:221330607 | RefSeq | XP_002077762.1 | 109 | GD22905 [Drosophila simulans] |