Gene/Proteome Database (LMPD)
Proteins
| phosphatidylinositol glycan anchor biosynthesis, class U ortholog | |
|---|---|
| Refseq ID | NP_609238 |
| Protein GI | 19920956 |
| UniProt ID | Q9VLK0 |
| mRNA ID | NM_135394 |
| Length | 426 |
| RefSeq Status | REVIEWED |
| MDSKFFKLLLLGGAVRFYFCRTPLAPMIGNRVEFATPLNSHKRMQEGIFLLQSGIDPYLGDLVHESPLILSALSGLFQKYPQFLPIFYIILDICTAALLYAMSLRFVKQKQDQQDKERKEYAKDTEELQFGPLDKLDIPELVIVAYLFSPLTVMSCIGMTSTVISNLFLAFFFYCLVKGMLIPCLLVLAFETVRSFYPIVLIAPLLLVFSRNSVRRGVAIAALFIVSCLIVAVANYFVLNSWNFLDGTLGFIFYFRDLQPNIGLFWYFFTEMFEHFRTMFLITFQLNATVLYLVPLSIKLRKEPLLLATVLVALMAVFRAYPSLGDVGFYLALLPLWKRCWKFMAHGFVVFTFFLVTLSMMGALWHLWIYAGSANANFYFGATLAFSTGQIFLITDLLFAHVKREFCLFNGQKILIDGEEARIVLK | |
Gene Information
Entrez Gene ID
Gene Name
Phosphatidylinositol glycan anchor biosynthesis, class U ortholog (H. sapiens)
Gene Symbol
Species
Drosophila melanogaster
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:InterPro | C | integral component of membrane |
| GO:0006506 | IEA:InterPro | P | GPI anchor biosynthetic process |
| GO:0042996 | IMP:FlyBase | P | regulation of Golgi to plasma membrane protein transport |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR009600 | GPI transamidase subunit PIG-U |
UniProt Annotations
Entry Information
Gene Name
Phosphatidylinositol glycan anchor biosynthesis, class U ortholog (H. sapiens)
Protein Entry
Q9VLK0_DROME
UniProt ID
Species
Drosophila
Identical and Related Proteins
Unique RefSeq proteins for LMP009007 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 19920956 | RefSeq | NP_609238 | 426 | phosphatidylinositol glycan anchor biosynthesis, class U ortholog |
Identical Sequences to LMP009007 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:19920956 | GenBank | AAL13897.1 | 426 | LD37974p [Drosophila melanogaster] |
| GI:19920956 | GenBank | ACL92582.1 | 426 | CG13089-PA, partial [synthetic construct] |
| GI:19920956 | gnl | FlyBase | 426 | phosphatidylinositol glycan anchor biosynthesis, class U ortholog [Drosophila melanogaster] |
Related Sequences to LMP009007 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:19920956 | GenBank | EDV58273.1 | 426 | GG25290 [Drosophila erecta] |
| GI:19920956 | GenBank | EDW88546.1 | 426 | GE18782 [Drosophila yakuba] |
| GI:19920956 | GenBank | EDX04266.1 | 426 | GD23551 [Drosophila simulans] |
| GI:19920956 | RefSeq | XP_001969214.1 | 426 | GG25290 [Drosophila erecta] |
| GI:19920956 | RefSeq | XP_002088834.1 | 426 | GE18782 [Drosophila yakuba] |
| GI:19920956 | RefSeq | XP_002078681.1 | 426 | GD23551 [Drosophila simulans] |