Gene/Proteome Database (LMPD)
Proteins
CG4676 | |
---|---|
Refseq ID | NP_610853 |
Protein GI | 24653316 |
UniProt ID | Q0IGS7 |
mRNA ID | NM_137009 |
Length | 284 |
RefSeq Status | REVIEWED |
MMILRSWDRVKPRSISDFACFLLVAVFVPVTYIFHVTIVMPELFAIGGIWYTLLWLASLFLIFNITSNMLACMLVDTSIRKELLKPPLDAAQLARWHSCQDCQTLVPPRSWHCEVCNVCVLKRDHHCRFTCCCIGHHNYRYFFYYLVYMIIGSLAAAIMESIYLWHLHLDIYWRWSTLFTIFAPVVSLMLSPSWESFYLVIYDLTLLGFAISSLLLVFHWSIFKSGSVTRERGTRKYDRGLRGNLEMVLGKRMHLTWLSPFLRSDLPHDGMNWEPIAAFSPKEE |
Gene Information
Entrez Gene ID
Gene Name
CG4676 gene product from transcript CG4676-RA
Gene Symbol
Species
Drosophila melanogaster
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005783 | IDA:FlyBase | C | endoplasmic reticulum |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0019706 | ISS:FlyBase | F | protein-cysteine S-palmitoyltransferase activity |
GO:0008270 | IEA:InterPro | F | zinc ion binding |
GO:0018345 | ISS:FlyBase | P | protein palmitoylation |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR001594 | Zinc finger, DHHC-type, palmitoyltransferase |
UniProt Annotations
Entry Information
Gene Name
CG4676 gene product from transcript CG4676-RA
Protein Entry
Q0IGS7_DROME
UniProt ID
Species
Drosophila
Comments
Comment Type | Description |
---|---|
Catalytic Activity | Palmitoyl-CoA + [protein]-L-cysteine = [protein]-S-palmitoyl-L-cysteine + CoA. |
Domain | The DHHC domain is required for palmitoyltransferase activity. |
Similarity | Belongs to the DHHC palmitoyltransferase family. |
Similarity | Contains 1 DHHC-type zinc finger. |
Similarity | Contains DHHC-type zinc finger. |
Identical and Related Proteins
Unique RefSeq proteins for LMP009077 (as displayed in Record Overview)
Identical Sequences to LMP009077 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:24653316 | GenBank | ABI34224.2 | 284 | RT01106p [Drosophila melanogaster] |
GI:24653316 | gnl | FlyBase | 284 | CG4676 [Drosophila melanogaster] |
Related Sequences to LMP009077 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:24653316 | GenBank | EDW47697.1 | 283 | GM21456 [Drosophila sechellia] |
GI:24653316 | GenBank | EDW90642.1 | 283 | GE12528 [Drosophila yakuba] |
GI:24653316 | GenBank | EDX06901.1 | 283 | GD10954 [Drosophila simulans] |
GI:24653316 | RefSeq | XP_002033684.1 | 283 | GM21456 [Drosophila sechellia] |
GI:24653316 | RefSeq | XP_002090930.1 | 283 | GE12528 [Drosophila yakuba] |
GI:24653316 | RefSeq | XP_002081316.1 | 283 | GD10954 [Drosophila simulans] |