Gene/Proteome Database (LMPD)
Proteins
CG17197 | |
---|---|
Refseq ID | NP_651425 |
Protein GI | 221459571 |
UniProt ID | Q9VBM7 |
mRNA ID | NM_143168 |
Length | 290 |
RefSeq Status | REVIEWED |
MCLIWACTKYLARRNPKIFVRISHPTAVLFVIVTTIFFVVLQMFYVVPQLFDVQGFMYKLGWLVAIFITYNIFGNMLACHITSTSVESLPKDRQIPEPEEEHQWHYCDVCEKLMPPRSWHCILCKCCILKRDRHCIFTASCVGHNNQRYFFWFTLFMALGTGVALATHIIATLKYFSYSDLIFLNIPRDNLPPFWLVITLILNTYVFAAPVSSVLMQLSVLKNNGTLHKFYSDTYDLGLWENFKLILGGKGFWTFLSPTVKSPLPHDGAQWKIKRVQHHSPKLQFLRVSD |
Gene Information
Entrez Gene ID
Gene Name
CG17197 gene product from transcript CG17197-RB
Gene Symbol
Species
Drosophila melanogaster
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005783 | IDA:FlyBase | C | endoplasmic reticulum |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0019706 | ISS:FlyBase | F | protein-cysteine S-palmitoyltransferase activity |
GO:0008270 | IEA:InterPro | F | zinc ion binding |
GO:0018345 | ISS:FlyBase | P | protein palmitoylation |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR001594 | Zinc finger, DHHC-type, palmitoyltransferase |
UniProt Annotations
Entry Information
Gene Name
CG17197 gene product from transcript CG17197-RB
Protein Entry
Q9VBM7_DROME
UniProt ID
Species
Drosophila
Comments
Comment Type | Description |
---|---|
Catalytic Activity | Palmitoyl-CoA + [protein]-L-cysteine = [protein]-S-palmitoyl-L-cysteine + CoA. |
Domain | The DHHC domain is required for palmitoyltransferase activity. |
Similarity | Belongs to the DHHC palmitoyltransferase family. |
Similarity | Contains 1 DHHC-type zinc finger. |
Similarity | Contains DHHC-type zinc finger. |
Identical and Related Proteins
Unique RefSeq proteins for LMP009085 (as displayed in Record Overview)
Identical Sequences to LMP009085 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:221459571 | GenBank | AAY51575.1 | 290 | IP01230p [Drosophila melanogaster] |
GI:221459571 | GenBank | ACL84243.1 | 290 | CG17197-PB, partial [synthetic construct] |
GI:221459571 | GenBank | ACL89196.1 | 290 | CG17197-PB [synthetic construct] |
GI:221459571 | gnl | FlyBase | 290 | CG17197 [Drosophila melanogaster] |
Related Sequences to LMP009085 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:221459571 | GenBank | EDV53626.1 | 281 | GG12221 [Drosophila erecta] |
GI:221459571 | GenBank | EDW45029.1 | 288 | GM10221 [Drosophila sechellia] |
GI:221459571 | GenBank | EDW98708.1 | 276 | GE10668 [Drosophila yakuba] |
GI:221459571 | RefSeq | XP_001981756.1 | 281 | GG12221 [Drosophila erecta] |
GI:221459571 | RefSeq | XP_002041291.1 | 288 | GM10221 [Drosophila sechellia] |
GI:221459571 | RefSeq | XP_002098996.1 | 276 | GE10668 [Drosophila yakuba] |