Gene/Proteome Database (LMPD)
Proteins
| CG5880 | |
|---|---|
| Refseq ID | NP_651539 |
| Protein GI | 45550841 |
| UniProt ID | Q9VB73 |
| mRNA ID | NM_143282 |
| Length | 381 |
| RefSeq Status | REVIEWED |
| MTRITWRGHSTQELLSILRLRWSYMKHCWHSLTFNAHMNSSYASDVCLTPIFWFVDNYTHCLGPFFVVGVAALTTSVVSIAYWIGLPFWWAKSQLVTYFLLIVGNWLLLNVVFHYVMAVITPAGHPPEGVSLVEAVSMCGKCIAPKPPRTHHCSICNRCILKMDHHCPWLNNCVGYGNHRYFFLYMTYTTLGCLFLILFGLEIGHKYLWLDHGENWTEIEPLEGQPVKFNLSGHIIPVTHPNEYDEFVLPPAVHNLPTPIVDTDAASPGRRRALWFMAFTNVAVVLALGSLSIWHAKLITRGETSVEAHINEAERKRHLQQQRIYINPYNFGTKKNWKLFLGLVRGRSFWRTVLLPSWHKPEGTGLSFHTVNDAPFEDEWP | |
Gene Information
Entrez Gene ID
Gene Name
CG5880 gene product from transcript CG5880-RA
Gene Symbol
Species
Drosophila melanogaster
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005794 | IDA:FlyBase | C | Golgi apparatus |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0019706 | ISS:FlyBase | F | protein-cysteine S-palmitoyltransferase activity |
| GO:0008270 | IEA:InterPro | F | zinc ion binding |
| GO:0018345 | ISS:FlyBase | P | protein palmitoylation |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR001594 | Zinc finger, DHHC-type, palmitoyltransferase |
UniProt Annotations
Entry Information
Gene Name
CG5880 gene product from transcript CG5880-RA
Protein Entry
Q9VB73_DROME
UniProt ID
Species
Drosophila
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Palmitoyl-CoA + [protein]-L-cysteine = [protein]-S-palmitoyl-L-cysteine + CoA. |
| Domain | The DHHC domain is required for palmitoyltransferase activity. |
| Similarity | Belongs to the DHHC palmitoyltransferase family. |
| Similarity | Contains 1 DHHC-type zinc finger. |
| Similarity | Contains DHHC-type zinc finger. |
Identical and Related Proteins
Unique RefSeq proteins for LMP009089 (as displayed in Record Overview)
Identical Sequences to LMP009089 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:45550841 | GenBank | ADY17805.1 | 381 | RT11029p [Drosophila melanogaster] |
| GI:45550841 | gnl | FlyBase | 381 | CG5880 [Drosophila melanogaster] |
Related Sequences to LMP009089 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:45550841 | GenBank | EDW45203.1 | 381 | GM10369 [Drosophila sechellia] |
| GI:45550841 | GenBank | EDW98542.1 | 381 | GE23718 [Drosophila yakuba] |
| GI:45550841 | GenBank | ADX35965.1 | 381 | RT10821p [Drosophila melanogaster] |
| GI:45550841 | RefSeq | XP_001981588.1 | 381 | GG11528 [Drosophila erecta] |
| GI:45550841 | RefSeq | XP_002041465.1 | 381 | GM10369 [Drosophila sechellia] |
| GI:45550841 | RefSeq | XP_002098830.1 | 381 | GE23718 [Drosophila yakuba] |