Gene/Proteome Database (LMPD)
Proteins
PRL-1, isoform A | |
---|---|
Refseq ID | NP_723956 |
Protein GI | 24584562 |
UniProt ID | O61722 |
mRNA ID | NM_165150 |
Length | 176 |
RefSeq Status | REVIEWED |
Protein sequence is identical to GI:442627987 (mRNA isoform) |
PRL-1, isoform B | |
---|---|
Refseq ID | NP_609780 |
Protein GI | 19921348 |
UniProt ID | O61722 |
mRNA ID | NM_135936 |
Length | 176 |
RefSeq Status | REVIEWED |
Protein sequence is identical to GI:442627987 (mRNA isoform) |
PRL-1, isoform C | |
---|---|
Refseq ID | NP_001260487 |
Protein GI | 442627987 |
UniProt ID | O61722 |
mRNA ID | NM_001273558 |
Length | 176 |
RefSeq Status | REVIEWED |
MSITMRQKDLRPAPALIEYKGMKFLITDRPSDITINHYIMELKKNNVNTVVRVCEPSYNTDELETQGITVKDLAFEDGTFPPQQVVDEWFEVLKDKYQQNPEACVAVHCVAGLGRAPVLVALALIELGLKYEAAVEMIRDKRRGAINAKQLSFLEKYKPKARLKHKNGHKNSCSVQ |
PRL-1, isoform D | |
---|---|
Refseq ID | NP_001260488 |
Protein GI | 442627989 |
UniProt ID | O61722 |
mRNA ID | NM_001273559 |
Length | 176 |
RefSeq Status | REVIEWED |
Protein sequence is identical to GI:442627987 (mRNA isoform) |
Gene Information
Entrez Gene ID
Gene Name
CG4993 gene product from transcript CG4993-RB
Gene Symbol
Species
Drosophila melanogaster
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005737 | IDA:FlyBase | C | cytoplasm |
GO:0005886 | IDA:FlyBase | C | plasma membrane |
GO:0004727 | ISS:FlyBase | F | prenylated protein tyrosine phosphatase activity |
GO:0008138 | NAS:FlyBase | F | protein tyrosine/serine/threonine phosphatase activity |
GO:0035335 | ISS:GOC | P | peptidyl-tyrosine dephosphorylation |
GO:0006470 | NAS:FlyBase | P | protein dephosphorylation |
Domain Information
UniProt Annotations
Entry Information
Gene Name
CG4993 gene product from transcript CG4993-RB
Protein Entry
O61722_DROME
UniProt ID
Species
Drosophila
Identical and Related Proteins
Unique RefSeq proteins for LMP009112 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
442627987 | RefSeq | NP_001260487 | 176 | PRL-1, isoform C |
Identical Sequences to LMP009112 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:442627987 | GenBank | EDW89684.1 | 176 | GE19374 [Drosophila yakuba] |
GI:442627987 | gnl | FlyBase | 176 | PRL-1, isoform C [Drosophila melanogaster] |
GI:442627987 | gnl | FlyBase | 176 | PRL-1, isoform D [Drosophila melanogaster] |
GI:442627987 | RefSeq | XP_001969025.1 | 176 | GG24181 [Drosophila erecta] |
GI:442627987 | RefSeq | XP_002089972.1 | 176 | GE19374 [Drosophila yakuba] |
GI:442627987 | RefSeq | NP_001260488.1 | 176 | PRL-1, isoform D [Drosophila melanogaster] |
Related Sequences to LMP009112 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:442627987 | GenBank | AAL26988.1 | 172 | protein tyrosine phosphatase [Drosophila melanogaster] |
GI:442627987 | GenBank | EDW54559.1 | 172 | GM17919 [Drosophila sechellia] |
GI:442627987 | GenBank | EDX05194.1 | 172 | GD21928 [Drosophila simulans] |
GI:442627987 | RefSeq | XP_002038141.1 | 172 | GM17919 [Drosophila sechellia] |
GI:442627987 | RefSeq | XP_002065091.1 | 176 | GK14857 [Drosophila willistoni] |
GI:442627987 | RefSeq | XP_002079609.1 | 172 | GD21928 [Drosophila simulans] |