Gene/Proteome Database (LMPD)
Proteins
| PRL-1, isoform A | |
|---|---|
| Refseq ID | NP_723956 |
| Protein GI | 24584562 |
| UniProt ID | O61722 |
| mRNA ID | NM_165150 |
| Length | 176 |
| RefSeq Status | REVIEWED |
| Protein sequence is identical to GI:442627987 (mRNA isoform) | |
| PRL-1, isoform B | |
|---|---|
| Refseq ID | NP_609780 |
| Protein GI | 19921348 |
| UniProt ID | O61722 |
| mRNA ID | NM_135936 |
| Length | 176 |
| RefSeq Status | REVIEWED |
| Protein sequence is identical to GI:442627987 (mRNA isoform) | |
| PRL-1, isoform C | |
|---|---|
| Refseq ID | NP_001260487 |
| Protein GI | 442627987 |
| UniProt ID | O61722 |
| mRNA ID | NM_001273558 |
| Length | 176 |
| RefSeq Status | REVIEWED |
| MSITMRQKDLRPAPALIEYKGMKFLITDRPSDITINHYIMELKKNNVNTVVRVCEPSYNTDELETQGITVKDLAFEDGTFPPQQVVDEWFEVLKDKYQQNPEACVAVHCVAGLGRAPVLVALALIELGLKYEAAVEMIRDKRRGAINAKQLSFLEKYKPKARLKHKNGHKNSCSVQ | |
| PRL-1, isoform D | |
|---|---|
| Refseq ID | NP_001260488 |
| Protein GI | 442627989 |
| UniProt ID | O61722 |
| mRNA ID | NM_001273559 |
| Length | 176 |
| RefSeq Status | REVIEWED |
| Protein sequence is identical to GI:442627987 (mRNA isoform) | |
Gene Information
Entrez Gene ID
Gene Name
CG4993 gene product from transcript CG4993-RB
Gene Symbol
Species
Drosophila melanogaster
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | IDA:FlyBase | C | cytoplasm |
| GO:0005886 | IDA:FlyBase | C | plasma membrane |
| GO:0004727 | ISS:FlyBase | F | prenylated protein tyrosine phosphatase activity |
| GO:0008138 | NAS:FlyBase | F | protein tyrosine/serine/threonine phosphatase activity |
| GO:0035335 | ISS:GOC | P | peptidyl-tyrosine dephosphorylation |
| GO:0006470 | NAS:FlyBase | P | protein dephosphorylation |
Domain Information
UniProt Annotations
Entry Information
Gene Name
CG4993 gene product from transcript CG4993-RB
Protein Entry
O61722_DROME
UniProt ID
Species
Drosophila
Identical and Related Proteins
Unique RefSeq proteins for LMP009112 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 442627987 | RefSeq | NP_001260487 | 176 | PRL-1, isoform C |
Identical Sequences to LMP009112 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:442627987 | GenBank | EDW89684.1 | 176 | GE19374 [Drosophila yakuba] |
| GI:442627987 | gnl | FlyBase | 176 | PRL-1, isoform C [Drosophila melanogaster] |
| GI:442627987 | gnl | FlyBase | 176 | PRL-1, isoform D [Drosophila melanogaster] |
| GI:442627987 | RefSeq | XP_001969025.1 | 176 | GG24181 [Drosophila erecta] |
| GI:442627987 | RefSeq | XP_002089972.1 | 176 | GE19374 [Drosophila yakuba] |
| GI:442627987 | RefSeq | NP_001260488.1 | 176 | PRL-1, isoform D [Drosophila melanogaster] |
Related Sequences to LMP009112 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:442627987 | GenBank | AAL26988.1 | 172 | protein tyrosine phosphatase [Drosophila melanogaster] |
| GI:442627987 | GenBank | EDW54559.1 | 172 | GM17919 [Drosophila sechellia] |
| GI:442627987 | GenBank | EDX05194.1 | 172 | GD21928 [Drosophila simulans] |
| GI:442627987 | RefSeq | XP_002038141.1 | 172 | GM17919 [Drosophila sechellia] |
| GI:442627987 | RefSeq | XP_002065091.1 | 176 | GK14857 [Drosophila willistoni] |
| GI:442627987 | RefSeq | XP_002079609.1 | 172 | GD21928 [Drosophila simulans] |