Gene/Proteome Database (LMPD)
LMPD ID
LMP009167
Gene ID
Species
Drosophila melanogaster (Drosophila)
Gene Name
CG16982 gene product from transcript CG16982-RC
Gene Symbol
Synonyms
anon-EST:Posey65; BEST:CK01110; CG16982; CK01110; Dmel\CG16982; dRbx1; dRoc1; dRoc1a; EG:115C2.11; Rbx1; Rbx1/Roc; ROC1; Roc1alpha
Chromosome
X
Map Location
1B13-1B13
Proteins
| Roc1a, isoform A | |
|---|---|
| Refseq ID | NP_569852 |
| Protein GI | 18543187 |
| UniProt ID | X2JA05 |
| mRNA ID | NM_130496 |
| Length | 108 |
| RefSeq Status | REVIEWED |
| Protein sequence is identical to GI:665388980 (mRNA isoform) | |
| Roc1a, isoform C | |
|---|---|
| Refseq ID | NP_001138143 |
| Protein GI | 386763546 |
| UniProt ID | Q9W5E1 |
| mRNA ID | NM_001144671 |
| Length | 136 |
| RefSeq Status | REVIEWED |
| MEVDEDGYEVPSSSSKGDKKRFEVKKVSGQQKSRVIVNECTDGNTSSFPLRRKQWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWDFQKYGH | |
| Roc1a, isoform D | |
|---|---|
| Refseq ID | NP_001284754 |
| Protein GI | 665388980 |
| UniProt ID | X2JA05 |
| mRNA ID | NM_001297825 |
| Length | 108 |
| RefSeq Status | REVIEWED |
| MEVDEDGYEVPSSSSKGDKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWDFQKYGH | |
Gene Information
Entrez Gene ID
Gene Name
CG16982 gene product from transcript CG16982-RC
Gene Symbol
Species
Drosophila melanogaster
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0019005 | IDA:UniProtKB | C | SCF ubiquitin ligase complex |
| GO:0005737 | IEA:UniProtKB-KW | C | cytoplasm |
| GO:0005634 | IDA:UniProtKB | C | nucleus |
| GO:0004842 | IDA:FlyBase | F | ubiquitin-protein transferase activity |
| GO:0008270 | NAS:UniProtKB | F | zinc ion binding |
| GO:0008283 | IMP:FlyBase | P | cell proliferation |
| GO:0019915 | IDA:FlyBase | P | lipid storage |
| GO:0030178 | IMP:FlyBase | P | negative regulation of Wnt signaling pathway |
| GO:0022008 | IMP:FlyBase | P | neurogenesis |
| GO:0016322 | IMP:FlyBase | P | neuron remodeling |
| GO:0016567 | IDA:FlyBase | P | protein ubiquitination |
| GO:0006508 | IMP:FlyBase | P | proteolysis |
| GO:0007224 | NAS:UniProtKB | P | smoothened signaling pathway |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| M00384 | Cul3-SPOP complex |
| dme_M00384 | Cul3-SPOP complex |
| M00383 | ECV complex |
| dme_M00383 | ECV complex |
| dme03420 | Nucleotide excision repair |
| ko03420 | Nucleotide excision repair |
| dme04141 | Protein processing in endoplasmic reticulum |
| ko04141 | Protein processing in endoplasmic reticulum |
| M00380 | SCF-BTRC complex |
| dme_M00380 | SCF-BTRC complex |
| M00387 | SCF-FBW7 complex |
| dme_M00387 | SCF-FBW7 complex |
| M00381 | SCF-SKP2 complex |
| dme_M00381 | SCF-SKP2 complex |
| dme04350 | TGF-beta signaling pathway |
| ko04350 | TGF-beta signaling pathway |
| dme04120 | Ubiquitin mediated proteolysis |
| ko04120 | Ubiquitin mediated proteolysis |
| dme04310 | Wnt signaling pathway |
| ko04310 | Wnt signaling pathway |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| 6226444 | AMER1 mutants destabilize the destruction complex |
| 6226451 | APC truncation mutants are not K63 polyubiquitinated |
| 6226452 | APC truncation mutants have impaired AXIN binding |
| 6226453 | AXIN missense mutants destabilize the destruction complex |
| 6226440 | AXIN mutants destabilize the destruction complex, activating WNT signaling |
| 6226838 | Cellular response to hypoxia |
| 6226062 | Cellular responses to stress |
| 6226972 | Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants |
| 6226971 | Constitutive Signaling by NOTCH1 PEST Domain Mutants |
| 6226118 | Cytokine Signaling in Immune system |
| 6226439 | Degradation of beta-catenin by the destruction complex |
| 6225885 | Disease |
| 6226243 | FBXW7 Mutants and NOTCH1 in Cancer |
| 6226003 | Immune System |
| 6226754 | Interleukin-1 signaling |
| 6226973 | Loss of Function of FBXW7 in Cancer and NOTCH1 Signaling |
| 6226921 | NOTCH1 Intracellular Domain Regulates Transcription |
| 6226836 | Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha |
| 6226519 | RNF mutants show enhanced WNT signaling and proliferation |
| 6226837 | Regulation of Hypoxia-inducible Factor (HIF) by oxygen |
| 6226447 | S33 mutants of beta-catenin aren't phosphorylated |
| 6226448 | S37 mutants of beta-catenin aren't phosphorylated |
| 6226449 | S45 mutants of beta-catenin aren't phosphorylated |
| 6225975 | Signal Transduction |
| 6226117 | Signaling by Interleukins |
| 6226240 | Signaling by NOTCH |
| 6226239 | Signaling by NOTCH1 |
| 6226245 | Signaling by NOTCH1 HD Domain Mutants in Cancer |
| 6226246 | Signaling by NOTCH1 HD+PEST Domain Mutants in Cancer |
| 6226241 | Signaling by NOTCH1 PEST Domain Mutants in Cancer |
| 6226242 | Signaling by NOTCH1 in Cancer |
| 6226244 | Signaling by NOTCH1 t(7;9)(NOTCH1:M1580_K2555) Translocation Mutant |
| 6226441 | Signaling by WNT in cancer |
| 6226300 | Signaling by Wnt |
| 6226450 | T41 mutants of beta-catenin aren't phosphorylated |
| 6226517 | TCF dependent signaling in response to WNT |
| 6226445 | TCF7L2 mutants don't bind CTBP |
| 6226520 | XAV939 inhibits tankyrase, stabilizing AXIN |
| 6226891 | degradation of DVL |
| 6226454 | deletions in the AMER1 gene destabilize the destruction complex |
| 6226455 | deletions in the AXIN genes in hepatocellular carcinoma result in elevated WNT signaling |
| 6226446 | misspliced GSK3beta mutants stabilize beta-catenin |
| 6226518 | misspliced LRP5 mutants have enhanced beta-catenin-dependent signaling |
| 6226442 | phosphorylation site mutants of CTNNB1 are not targeted to the proteasome by the destruction complex |
| 6226443 | truncated APC mutants destabilize the destruction complex |
| 6226456 | truncations of AMER1 destabilize the destruction complex |
Domain Information
UniProt Annotations
Entry Information
Gene Name
CG16982 gene product from transcript CG16982-RC
Protein Entry
RBX1A_DROME
UniProt ID
Species
Drosophila
Comments
| Comment Type | Description |
|---|---|
| Developmental Stage | Expressed both maternally and zygotically. {ECO:0000269|PubMed:12062088}. |
| Domain | The RING-type zinc finger domain is essential for ubiquitin ligase activity. It coordinates an additional third zinc ion (By similarity). {ECO:0000250}. |
| Function | Component of the SCF (SKP1-CUL1-F-box protein) E3 ubiquitin ligase complex, which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Through the RING-type zinc finger, seems to recruit the E2 ubiquitination enzyme to the complex and brings it into close proximity to the substrate. Required for the specific SCF-dependent proteolysis of CI, but not that of ARM, suggesting that it also participates in the selection of substrates inside the SCF complex. {ECO:0000269|PubMed:12062088}. |
| Pathway | Protein modification; protein ubiquitination. |
| Sequence Caution | Sequence=CAA20888.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; |
| Similarity | Belongs to the RING-box family. {ECO:0000305}. |
| Similarity | Contains 1 RING-type zinc finger. {ECO:0000255|PROSITE-ProRule:PRU00175}. |
| Subcellular Location | Cytoplasm. Nucleus. |
| Subunit | Part of a SCF complex consisting of Skpa (SKP1), Lin19 (CUL1), Roc1A and F-box protein Slmb. Interacts directly with Lin19 and Slmb. {ECO:0000269|PubMed:11500045}. |
| Tissue Specificity | Widely expressed. Expressed in embryonic, larval and adult tissues. {ECO:0000269|PubMed:12062088}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP009167 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 386763546 | RefSeq | NP_001138143 | 136 | Roc1a, isoform C |
| 665388980 | RefSeq | NP_001284754 | 108 | Roc1a, isoform D |
Identical Sequences to LMP009167 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:386763546 | EMBL | CAA20888.1 | 136 | EG:115C2.11 [Drosophila melanogaster] |
| GI:665388980 | GenBank | EDW43727.1 | 108 | GM19082 [Drosophila sechellia] |
| GI:665388980 | GenBank | EDX16776.1 | 108 | GD16520 [Drosophila simulans] |
| GI:665388980 | GenBank | ACL88977.1 | 108 | Roc1a-PA [synthetic construct] |
| GI:386763546 | gnl | FlyBase | 136 | Roc1a, isoform C [Drosophila melanogaster] |
| GI:665388980 | gnl | FlyBase | 108 | Roc1a, isoform D [Drosophila melanogaster] |
| GI:665388980 | RefSeq | XP_002040256.1 | 108 | GM19082 [Drosophila sechellia] |
| GI:665388980 | RefSeq | XP_002105838.1 | 108 | GD16520 [Drosophila simulans] |
Related Sequences to LMP009167 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:386763546 | GenBank | AAM51125.1 | 108 | SD23839p [Drosophila melanogaster] |
| GI:386763546 | GenBank | AAY02500.1 | 108 | Sequence 6 from patent US 6858709 |
| GI:665388980 | GenBank | EDW06078.1 | 108 | GI16422 [Drosophila mojavensis] |
| GI:386763546 | gnl | FlyBase | 108 | Roc1a, isoform D [Drosophila melanogaster] |
| GI:665388980 | RefSeq | XP_001966452.1 | 108 | GF22186 [Drosophila ananassae] |
| GI:665388980 | RefSeq | XP_001982417.1 | 108 | GG12803 [Drosophila erecta] |
| GI:665388980 | RefSeq | XP_001995546.1 | 108 | GH17811 [Drosophila grimshawi] |
| GI:665388980 | RefSeq | XP_002011236.1 | 108 | GI16422 [Drosophila mojavensis] |
| GI:665388980 | RefSeq | XP_002025205.1 | 108 | GL13357 [Drosophila persimilis] |
| GI:386763546 | RefSeq | XP_002040256.1 | 108 | GM19082 [Drosophila sechellia] |
| GI:386763546 | RefSeq | XP_002105838.1 | 108 | GD16520 [Drosophila simulans] |
| GI:386763546 | RefSeq | NP_001284754.1 | 108 | Roc1a, isoform D [Drosophila melanogaster] |