Gene/Proteome Database (LMPD)
Proteins
| putative 3-hydroxyacyl-[acyl-carrier-protein] dehydratase | |
|---|---|
| Refseq ID | NP_196578 |
| Protein GI | 15238069 |
| UniProt ID | Q9LX13 |
| mRNA ID | NM_121054 |
| Length | 219 |
| RefSeq Status | REVIEWED |
| MAASSSVFTVSPSRNLAAIPLHQSLSPPLLRSSSVAFRPKRRSSSLVLCSTDESKSTAEKEIPIELRYEAFPTVMDINKIQEILPHRFPFLLVDRVIEYTAGVSAVAIKNVTINDNFFPGHFPERPIMPGVLMVEAMAQVGGIVMLQPEVGGSRSNFFFAGIDKVRFRKPVIAGDTLVMRMTLVKLQKRFGIAKMEGKAYVGNSVVCEGEFLMAMGKEE | |
Gene Information
Entrez Gene ID
Gene Name
putative 3-hydroxyacyl-[acyl-carrier-protein] dehydratase
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005618 | IDA:TAIR | C | cell wall |
| GO:0009507 | IDA:TAIR | C | chloroplast |
| GO:0009941 | IDA:TAIR | C | chloroplast envelope |
| GO:0009534 | IDA:TAIR | C | chloroplast thylakoid |
| GO:0016020 | IDA:TAIR | C | membrane |
| GO:0016836 | IEA:InterPro | F | hydro-lyase activity |
| GO:0006633 | IEA:InterPro | P | fatty acid biosynthetic process |
Domain Information
UniProt Annotations
Entry Information
Gene Name
putative 3-hydroxyacyl-[acyl-carrier-protein] dehydratase
Protein Entry
Q9LX13_ARATH
UniProt ID
Species
Arabidopsis
Identical and Related Proteins
Unique RefSeq proteins for LMP009627 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 15238069 | RefSeq | NP_196578 | 219 | putative 3-hydroxyacyl-[acyl-carrier-protein] dehydratase |
Identical Sequences to LMP009627 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15238069 | DBBJ | BAE99645.1 | 219 | hypothetical protein [Arabidopsis thaliana] |
| GI:15238069 | EMBL | CAB92057.1 | 219 | (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase-like protein [Arabidopsis thaliana] |
| GI:15238069 | EMBL | CAY02651.1 | 219 | unnamed protein product [Arabidopsis thaliana] |
| GI:15238069 | GenBank | AAO24548.1 | 219 | At5g10160 [Arabidopsis thaliana] |
| GI:15238069 | GenBank | ADT60360.1 | 219 | Sequence 1610 from patent US 7847156 |
| GI:15238069 | gnl | TAIR | 219 | putative 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [Arabidopsis thaliana] |
Related Sequences to LMP009627 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15238069 | EMBL | CAY02644.1 | 219 | unnamed protein product [Arabidopsis thaliana] |
| GI:15238069 | GenBank | EFH47666.1 | 219 | hypothetical protein ARALYDRAFT_487843 [Arabidopsis lyrata subsp. lyrata] |
| GI:15238069 | GenBank | EOA21523.1 | 219 | hypothetical protein CARUB_v10001927mg [Capsella rubella] |
| GI:15238069 | RefSeq | XP_002871407.1 | 219 | hypothetical protein ARALYDRAFT_487843 [Arabidopsis lyrata subsp. lyrata] |
| GI:15238069 | RefSeq | XP_006288625.1 | 219 | hypothetical protein CARUB_v10001927mg [Capsella rubella] |
| GI:15238069 | RefSeq | XP_010422883.1 | 220 | PREDICTED: uncharacterized protein LOC104708088 [Camelina sativa] |