Gene/Proteome Database (LMPD)
LMPD ID
LMP009653
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
1-acyl-sn-glycerol-3-phosphate acyltransferase 1
Gene Symbol
Synonyms
EMB1995; EMBRYO DEFECTIVE 1995; F17I23.80; F17I23_80; LPAT1; lysophosphatidic acid acyltransferase 1; PHOSPHOLIPID/GLYCEROL ACYLTRANSFERASE
Alternate Names
1-acyl-sn-glycerol-3-phosphate acyltransferase 1
Chromosome
4
EC Number
2.3.1.51
Summary
Encodes a plastidic lysophosphatidic acid acyltransferase (LPAAT). Is critical for chloroplasts phosphatidic acid biosynthesis. The null allele is embryo lethal.
Orthologs
Proteins
| 1-acyl-sn-glycerol-3-phosphate acyltransferase 1 | |
|---|---|
| Refseq ID | NP_194787 |
| Protein GI | 30688731 |
| UniProt ID | Q8GXU8 |
| mRNA ID | NM_119204 |
| Length | 356 |
| RefSeq Status | REVIEWED |
| MDVASARSISSHPSYYGKPICSSQSSLIRISRDKVCCFGRISNGMTSFTTSLHAVPSEKFMGETRRTGIQWSNRSLRHDPYRFLDKKSPRSSQLARDITVRADLSGAATPDSSFPEPEIKLSSRLRGIFFCVVAGISATFLIVLMIIGHPFVLLFDPYRRKFHHFIAKLWASISIYPFYKINIEGLENLPSSDTPAVYVSNHQSFLDIYTLLSLGKSFKFISKTGIFVIPIIGWAMSMMGVVPLKRMDPRSQVDCLKRCMELLKKGASVFFFPEGTRSKDGRLGSFKKGAFTVAAKTGVAVVPITLMGTGKIMPTGSEGILNHGNVRVIIHKPIHGSKADVLCNEARSKIAESMDL | |
Gene Information
Entrez Gene ID
Gene Name
1-acyl-sn-glycerol-3-phosphate acyltransferase 1
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0009507 | IDA:TAIR | C | chloroplast |
| GO:0009941 | IDA:TAIR | C | chloroplast envelope |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0009536 | IDA:TAIR | C | plastid |
| GO:0003841 | IGI:TAIR | F | 1-acylglycerol-3-phosphate O-acyltransferase activity |
| GO:0016024 | IEA:UniProtKB-UniPathway | P | CDP-diacylglycerol biosynthetic process |
| GO:0009793 | IMP:TAIR | P | embryo development ending in seed dormancy |
| GO:0006655 | IMP:TAIR | P | phosphatidylglycerol biosynthetic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ath00561 | Glycerolipid metabolism |
| ath00564 | Glycerophospholipid metabolism |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
1-acyl-sn-glycerol-3-phosphate acyltransferase 1
Protein Entry
LPAT1_ARATH
UniProt ID
Species
Arabidopsis
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q8GXU8-1; Sequence=Displayed; Name=2; IsoId=Q8GXU8-2; Sequence=VSP_013594; Note=No experimental confirmation available.; |
| Catalytic Activity | Acyl-CoA + 1-acyl-sn-glycerol 3-phosphate = CoA + 1,2-diacyl-sn-glycerol 3-phosphate. {ECO:0000269|PubMed:14976237, ECO:0000269|PubMed:15169931}. |
| Developmental Stage | Expression transiently increases in siliques 4 hours after flowering. {ECO:0000269|PubMed:15169931}. |
| Domain | The HXXXXD motif is essential for acyltransferase activity and may constitute the binding site for the phosphate moiety of the glycerol-3-phosphate. {ECO:0000250}. |
| Function | Converts lysophosphatidic acid (LPA) into phosphatidic acid by incorporating acyl moiety at the 2 position. Has preference for C-16-CoA substrates compared to C-18-CoA substrates. Essential for embryo development during the transition from the globular to the heart stage when chloroplasts begin to form. {ECO:0000269|PubMed:14976237, ECO:0000269|PubMed:15169931}. |
| Pathway | Phospholipid metabolism; CDP-diacylglycerol biosynthesis; CDP-diacylglycerol from sn-glycerol 3-phosphate: step 2/3. |
| Similarity | Belongs to the 1-acyl-sn-glycerol-3-phosphate acyltransferase family. {ECO:0000305}. |
| Subcellular Location | Plastid, chloroplast membrane {ECO:0000269|PubMed:12766230, ECO:0000269|PubMed:15169931}; Multi- pass membrane protein {ECO:0000269|PubMed:12766230, ECO:0000269|PubMed:15169931}. |
| Tissue Specificity | Widely expressed. Expressed at higher level in leaves. Expressed at lower level in silique walls compared to leaves. {ECO:0000269|PubMed:14976237, ECO:0000269|PubMed:15169931}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP009653 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 30688731 | RefSeq | NP_194787 | 356 | 1-acyl-sn-glycerol-3-phosphate acyltransferase 1 |
Identical Sequences to LMP009653 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:30688731 | DBBJ | BAC42660.1 | 356 | unknown protein [Arabidopsis thaliana] |
| GI:30688731 | GenBank | AEE85783.1 | 356 | 1-acyl-sn-glycerol-3-phosphate acyltransferase 1 [Arabidopsis thaliana] |
| GI:30688731 | SwissProt | Q8GXU8.1 | 356 | RecName: Full=1-acyl-sn-glycerol-3-phosphate acyltransferase 1, chloroplastic; AltName: Full=Lysophosphatidyl acyltransferase 1; AltName: Full=Protein EMBRYO DEFECTIVE 1995; Flags: Precursor [Arabidopsis thaliana] |
Related Sequences to LMP009653 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:30688731 | GenBank | EFH43598.1 | 358 | hypothetical protein ARALYDRAFT_491693 [Arabidopsis lyrata subsp. lyrata] |
| GI:30688731 | GenBank | EOA16894.1 | 360 | hypothetical protein CARUB_v10005118mg [Capsella rubella] |
| GI:30688731 | RefSeq | XP_002867339.1 | 358 | hypothetical protein ARALYDRAFT_491693 [Arabidopsis lyrata subsp. lyrata] |
| GI:30688731 | RefSeq | XP_006283996.1 | 360 | hypothetical protein CARUB_v10005118mg [Capsella rubella] |
| GI:30688731 | RefSeq | XP_010438157.1 | 373 | PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 1, chloroplastic-like [Camelina sativa] |
| GI:30688731 | RefSeq | XP_010447697.1 | 373 | PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 1, chloroplastic [Camelina sativa] |