Gene/Proteome Database (LMPD)
LMPD ID
LMP009667
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
24-methylenesterol C-methyltransferase 2
Gene Symbol
Synonyms
COTYLEDON VASCULAR PATTERN 1; CVP1; F14O10.7; F14O10_7; FRILL1; FRL1; SMT2; sterol methyltransferase 2
Alternate Names
24-methylenesterol C-methyltransferase 2
Chromosome
1
EC Number
2.1.1.143
Summary
Encodes a sterol-C24-methyltransferases involved in sterol biosynthesis. Mutants display altered sterol composition, serrated petals and sepals and altered cotyledon vascular patterning as well as ectopic endoreduplication. This suggests that suppression of endoreduplication is important for petal morphogenesis and that normal sterol composition is required for this suppression.
Orthologs
Proteins
| 24-methylenesterol C-methyltransferase 2 | |
|---|---|
| Refseq ID | NP_173458 |
| Protein GI | 15217917 |
| UniProt ID | Q39227 |
| mRNA ID | NM_101884 |
| Length | 361 |
| RefSeq Status | REVIEWED |
| MDSLTLFFTGALVAVGIYWFLCVLGPAERKGKRAVDLSGGSISAEKVQDNYKQYWSFFRRPKEIETAEKVPDFVDTFYNLVTDIYEWGWGQSFHFSPSIPGKSHKDATRLHEEMAVDLIQVKPGQKILDVGCGVGGPMRAIASHSRANVVGITINEYQVNRARLHNKKAGLDALCEVVCGNFLQMPFDDNSFDGAYSIEATCHAPKLEEVYAEIYRVLKPGSMYVSYEWVTTEKFKAEDDEHVEVIQGIERGDALPGLRAYVDIAETAKKVGFEIVKEKDLASPPAEPWWTRLKMGRLAYWRNHIVVQILSAVGVAPKGTVDVHEMLFKTADYLTRGGETGIFSPMHMILCRKPESPEESS | |
Gene Information
Entrez Gene ID
Gene Name
24-methylenesterol C-methyltransferase 2
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005794 | IDA:TAIR | C | Golgi apparatus |
| GO:0005783 | IDA:TAIR | C | endoplasmic reticulum |
| GO:0030797 | IEA:UniProtKB-EC | F | 24-methylenesterol C-methyltransferase activity |
| GO:0008757 | IDA:TAIR | F | S-adenosylmethionine-dependent methyltransferase activity |
| GO:0009825 | IMP:TAIR | P | multidimensional cell growth |
| GO:0032876 | IMP:TAIR | P | negative regulation of DNA endoreduplication |
| GO:0007389 | IMP:TAIR | P | pattern specification process |
| GO:0016126 | IDA:TAIR | P | sterol biosynthetic process |
| GO:0010051 | IMP:TAIR | P | xylem and phloem pattern formation |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ath01110 | Biosynthesis of secondary metabolites |
| ath00100 | Steroid biosynthesis |
BIOCYC Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
24-methylenesterol C-methyltransferase 2
Protein Entry
SMT2_ARATH
UniProt ID
Species
Arabidopsis
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | S-adenosyl-L-methionine + 24-methylenelophenol = S-adenosyl-L-homocysteine + (Z)-24-ethylidenelophenol. |
| Function | Catalyzes the methyl transfer from S-adenosyl-methionine to the methylene group of 24-methylene lophenol to form 24- ethylidene lophenol. |
| Pathway | Steroid biosynthesis; sterol biosynthesis. |
| Similarity | Belongs to the class I-like SAM-binding methyltransferase superfamily. Erg6/SMT family. {ECO:0000255|PROSITE-ProRule:PRU01022}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP009667 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 15217917 | RefSeq | NP_173458 | 361 | 24-methylenesterol C-methyltransferase 2 |
Identical Sequences to LMP009667 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15217917 | GenBank | AAM45009.1 | 361 | putative sterol-C-methyltransferase [Arabidopsis thaliana] |
| GI:15217917 | GenBank | ACW87247.1 | 361 | Sequence 3868 from patent US 7569389 |
| GI:15217917 | GenBank | ACW97902.1 | 361 | Sequence 18346 from patent US 7569389 |
| GI:15217917 | GenBank | ADT59793.1 | 361 | Sequence 476 from patent US 7847156 |
| GI:15217917 | GenBank | AEE29962.1 | 361 | 24-methylenesterol C-methyltransferase 2 [Arabidopsis thaliana] |
| GI:15217917 | SwissProt | Q39227.2 | 361 | RecName: Full=24-methylenesterol C-methyltransferase 2; Short=24-sterol C-methyltransferase 2; Short=Sterol-C-methyltransferase 2; AltName: Full=Protein COTYLEDON VASCULAR PATTERN 1 [Arabidopsis thaliana] |
Related Sequences to LMP009667 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15217917 | EMBL | CAA61966.1 | 361 | sterol-C-methyltransferase [Arabidopsis thaliana] |
| GI:15217917 | GenBank | AAE68746.1 | 361 | Sequence 4 from patent US 6225075 |
| GI:15217917 | GenBank | AAM91592.1 | 361 | 24-sterol C-methyltransferase [Arabidopsis thaliana] |
| GI:15217917 | GenBank | AAN31890.1 | 361 | putative sterol-C-methyltransferase [Arabidopsis thaliana] |
| GI:15217917 | GenBank | AAN72104.1 | 361 | 24-sterol C-methyltransferase [Arabidopsis thaliana] |
| GI:15217917 | PRF | - | 361 | sterol C-methyltransferase [Arabidopsis thaliana] |