Gene/Proteome Database (LMPD)

LMPD ID
LMP009703
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
3-ketoacyl-CoA synthase 3
Gene Symbol
Synonyms
3-ketoacyl-CoA synthase 3; F24B9.18; F24B9_18; KCS3
Alternate Names
3-ketoacyl-CoA synthase 3
Chromosome
1
EC Number
2.3.1.199
Summary
Encodes KCS3, a member of the 3-ketoacyl-CoA synthase family involved in the biosynthesis of VLCFA (very long chain fatty acids).
Orthologs

Proteins

3-ketoacyl-CoA synthase 3
Refseq ID NP_172251
Protein GI 15222994
UniProt ID Q9LQP8
mRNA ID NM_100646
Length 478
RefSeq Status REVIEWED
MDLLVMLLSLLVSYLIFKIWKRIDSKRDQNCYILDYQCHKPSDDRMVNTQFSGDIILRNKHLRLNEYKFLLKAIVSSGIGEQTYAPRLFFEGREQRPTLQDGLSEMEEFYIDTIEKVLKRNKISPSEIDILVVNVSMLNSTPSLSARIINHYKMREDIKVFNLTAMGCSASVISIDIVKNIFKTYKNKLALVVTSESLSPNWYSGNNRSMILANCLFRSGGCAVLLTNKRSLSRRAMFKLRCLVRTHHGARDDSFNACVQKEDELGHIGVHLDKTLPKAATRAFIDNLKVITPKILPVTELLRFMLCLLLKKLRSSPSKGSTNVTQAAPKAGVKAGINFKTGIDHFCIHTGGKAVIDAIGYSLDLNEYDLEPARMTLHRFGNTSASSLWYVLGYMEAKKRLKRGDRVFMISFGAGFKCNSCVWEVVRDLNVGEAVGNVWNHCINQYPPKSILNPFFEKYGWIHEEEDPDTFKMPEGFM

Gene Information

Entrez Gene ID
Gene Name
3-ketoacyl-CoA synthase 3
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IDA:TAIR C endoplasmic reticulum
GO:0016020 IEA:InterPro C membrane
GO:0016747 IEA:InterPro F transferase activity, transferring acyl groups other than amino-acyl groups
GO:0006633 IEA:UniProtKB-UniPathway P fatty acid biosynthetic process
GO:0009409 IEP:TAIR P response to cold
GO:0009416 IEP:TAIR P response to light stimulus

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY-5080 very long chain fatty acid biosynthesis I

Domain Information

InterPro Annotations

Accession Description
IPR013747 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C-terminal
IPR013601 FAE1/Type III polyketide synthase-like protein
IPR016039 Thiolase-like
IPR016038 Thiolase-like, subgroup
IPR012392 Very-long-chain 3-ketoacyl-CoA synthase

UniProt Annotations

Entry Information

Gene Name
3-ketoacyl-CoA synthase 3
Protein Entry
KCS3_ARATH
UniProt ID
Species
Arabidopsis

Comments

Comment Type Description
Catalytic Activity A very-long-chain acyl-CoA + malonyl-CoA = CoA + a very-long-chain 3-oxoacyl-CoA + CO(2).
Induction Repressed by herbicides such as flufenacet and benfuresate. {ECO:0000269|PubMed:12916765}.
Pathway Lipid metabolism; fatty acid biosynthesis.
Similarity Belongs to the chalcone/stilbene synthases family. {ECO:0000305}.
Similarity Contains 1 FAE (fatty acid elongase) domain. {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP009703 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15222994 RefSeq NP_172251 478 3-ketoacyl-CoA synthase 3

Identical Sequences to LMP009703 proteins

Reference Database Accession Length Protein Name
GI:15222994 EMBL CAW71176.1 478 unnamed protein product [Arabidopsis thaliana]
GI:15222994 EMBL CBC11418.1 478 unnamed protein product [Arabidopsis thaliana]
GI:15222994 EMBL CBC60858.1 478 unnamed protein product [Arabidopsis thaliana]
GI:15222994 GenBank AEE28169.1 478 3-ketoacyl-CoA synthase 3 [Arabidopsis thaliana]
GI:15222994 GenBank AGD18273.1 478 Sequence 15729 from patent US 8343764
GI:15222994 SwissProt Q9LQP8.3 478 RecName: Full=3-ketoacyl-CoA synthase 3; Short=KCS-3; AltName: Full=Very long-chain fatty acid condensing enzyme 3; Short=VLCFA condensing enzyme 3; Flags: Precursor [Arabidopsis thaliana]

Related Sequences to LMP009703 proteins

Reference Database Accession Length Protein Name
GI:15222994 GenBank EFH68673.1 478 beta-ketoacyl-CoA synthase family protein [Arabidopsis lyrata subsp. lyrata]
GI:15222994 GenBank EOA37366.1 477 hypothetical protein CARUB_v10011152mg [Capsella rubella]
GI:15222994 RefSeq XP_002892414.1 478 beta-ketoacyl-CoA synthase family protein [Arabidopsis lyrata subsp. lyrata]
GI:15222994 RefSeq XP_006304468.1 477 hypothetical protein CARUB_v10011152mg [Capsella rubella]
GI:15222994 RefSeq XP_010457975.1 476 PREDICTED: 3-ketoacyl-CoA synthase 3 [Camelina sativa]
GI:15222994 RefSeq XP_010475542.1 476 PREDICTED: 3-ketoacyl-CoA synthase 3-like [Camelina sativa]