Gene/Proteome Database (LMPD)
LMPD ID
LMP009703
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
3-ketoacyl-CoA synthase 3
Gene Symbol
Synonyms
3-ketoacyl-CoA synthase 3; F24B9.18; F24B9_18; KCS3
Alternate Names
3-ketoacyl-CoA synthase 3
Chromosome
1
EC Number
2.3.1.199
Summary
Encodes KCS3, a member of the 3-ketoacyl-CoA synthase family involved in the biosynthesis of VLCFA (very long chain fatty acids).
Orthologs
Proteins
3-ketoacyl-CoA synthase 3 | |
---|---|
Refseq ID | NP_172251 |
Protein GI | 15222994 |
UniProt ID | Q9LQP8 |
mRNA ID | NM_100646 |
Length | 478 |
RefSeq Status | REVIEWED |
MDLLVMLLSLLVSYLIFKIWKRIDSKRDQNCYILDYQCHKPSDDRMVNTQFSGDIILRNKHLRLNEYKFLLKAIVSSGIGEQTYAPRLFFEGREQRPTLQDGLSEMEEFYIDTIEKVLKRNKISPSEIDILVVNVSMLNSTPSLSARIINHYKMREDIKVFNLTAMGCSASVISIDIVKNIFKTYKNKLALVVTSESLSPNWYSGNNRSMILANCLFRSGGCAVLLTNKRSLSRRAMFKLRCLVRTHHGARDDSFNACVQKEDELGHIGVHLDKTLPKAATRAFIDNLKVITPKILPVTELLRFMLCLLLKKLRSSPSKGSTNVTQAAPKAGVKAGINFKTGIDHFCIHTGGKAVIDAIGYSLDLNEYDLEPARMTLHRFGNTSASSLWYVLGYMEAKKRLKRGDRVFMISFGAGFKCNSCVWEVVRDLNVGEAVGNVWNHCINQYPPKSILNPFFEKYGWIHEEEDPDTFKMPEGFM |
Gene Information
Entrez Gene ID
Gene Name
3-ketoacyl-CoA synthase 3
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005783 | IDA:TAIR | C | endoplasmic reticulum |
GO:0016020 | IEA:InterPro | C | membrane |
GO:0016747 | IEA:InterPro | F | transferase activity, transferring acyl groups other than amino-acyl groups |
GO:0006633 | IEA:UniProtKB-UniPathway | P | fatty acid biosynthetic process |
GO:0009409 | IEP:TAIR | P | response to cold |
GO:0009416 | IEP:TAIR | P | response to light stimulus |
BIOCYC Pathway Links
BIOCYC Pathway ID | Description |
---|---|
PWY-5080 | very long chain fatty acid biosynthesis I |
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Catalytic Activity | A very-long-chain acyl-CoA + malonyl-CoA = CoA + a very-long-chain 3-oxoacyl-CoA + CO(2). |
Induction | Repressed by herbicides such as flufenacet and benfuresate. {ECO:0000269|PubMed:12916765}. |
Pathway | Lipid metabolism; fatty acid biosynthesis. |
Similarity | Belongs to the chalcone/stilbene synthases family. {ECO:0000305}. |
Similarity | Contains 1 FAE (fatty acid elongase) domain. {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP009703 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
15222994 | RefSeq | NP_172251 | 478 | 3-ketoacyl-CoA synthase 3 |
Identical Sequences to LMP009703 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:15222994 | EMBL | CAW71176.1 | 478 | unnamed protein product [Arabidopsis thaliana] |
GI:15222994 | EMBL | CBC11418.1 | 478 | unnamed protein product [Arabidopsis thaliana] |
GI:15222994 | EMBL | CBC60858.1 | 478 | unnamed protein product [Arabidopsis thaliana] |
GI:15222994 | GenBank | AEE28169.1 | 478 | 3-ketoacyl-CoA synthase 3 [Arabidopsis thaliana] |
GI:15222994 | GenBank | AGD18273.1 | 478 | Sequence 15729 from patent US 8343764 |
GI:15222994 | SwissProt | Q9LQP8.3 | 478 | RecName: Full=3-ketoacyl-CoA synthase 3; Short=KCS-3; AltName: Full=Very long-chain fatty acid condensing enzyme 3; Short=VLCFA condensing enzyme 3; Flags: Precursor [Arabidopsis thaliana] |
Related Sequences to LMP009703 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:15222994 | GenBank | EFH68673.1 | 478 | beta-ketoacyl-CoA synthase family protein [Arabidopsis lyrata subsp. lyrata] |
GI:15222994 | GenBank | EOA37366.1 | 477 | hypothetical protein CARUB_v10011152mg [Capsella rubella] |
GI:15222994 | RefSeq | XP_002892414.1 | 478 | beta-ketoacyl-CoA synthase family protein [Arabidopsis lyrata subsp. lyrata] |
GI:15222994 | RefSeq | XP_006304468.1 | 477 | hypothetical protein CARUB_v10011152mg [Capsella rubella] |
GI:15222994 | RefSeq | XP_010457975.1 | 476 | PREDICTED: 3-ketoacyl-CoA synthase 3 [Camelina sativa] |
GI:15222994 | RefSeq | XP_010475542.1 | 476 | PREDICTED: 3-ketoacyl-CoA synthase 3-like [Camelina sativa] |