Gene/Proteome Database (LMPD)

LMPD ID
LMP009706
Gene ID
843182
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
3-ketoacyl-CoA synthase 6
Gene Symbol
KCS6
Synonyms
3-ketoacyl-CoA synthase 6; CER6; CUT1; CUTICULAR 1; ECERIFERUM 6; G2; KCS6; POLLEN-PISTIL INCOMPATIBILITY 1; POP1; T26J14.10; T26J14_10
Alternate Names
3-ketoacyl-CoA synthase 6
Chromosome
1
EC Number
2.3.1.199
Summary
Encodes KCS6, a member of the 3-ketoacyl-CoA synthase family involved in the biosynthesis of VLCFA (very long chain fatty acids).
Orthologs
View orthologs and multiple alignments for KCS6

Proteins

3-ketoacyl-CoA synthase 6
Refseq ID NP_849861
Protein GI 30697701
UniProt ID Q9XF43
mRNA ID NM_179530
Length 377
RefSeq Status REVIEWED
MPQAPMPEFSSSVKLKYVKLGYQYLVNHFLSFLLIPIMAIVAVELLRMGPEEILNVWNSLQFDLVQVLCSSFFVIFISTVYFMSKPRTIYLVDYSCYKPPVTCRVPFATFMEHSRLILKDKPKSVEFQMRILERSGLGEETCLPPAIHYIPPTPTMDAARSEAQMVIFEAMDDLFKKTGLKPKDVDILIVNCSLFSPTPSLSAMVINKYKLRSNIKSFNLSGMGCSAGLISVDLARDLLQVHPNSNAIIVSTEIITPNYYQGNERAMLLPNCLFRMGAAAIHMSNRRSDRWRAKYKLSHLVRTHRGADDKSFYCVYEQEDKEGHVGINLSKDLMAIAGEALKANITTIGNKHTSFYFTYIYTLTMIYTVKTISRGGH
3-ketoacyl-CoA synthase 6
Refseq ID NP_177020
Protein GI 15221431
UniProt ID Q9XF43
mRNA ID NM_105524
Length 497
RefSeq Status REVIEWED
MPQAPMPEFSSSVKLKYVKLGYQYLVNHFLSFLLIPIMAIVAVELLRMGPEEILNVWNSLQFDLVQVLCSSFFVIFISTVYFMSKPRTIYLVDYSCYKPPVTCRVPFATFMEHSRLILKDKPKSVEFQMRILERSGLGEETCLPPAIHYIPPTPTMDAARSEAQMVIFEAMDDLFKKTGLKPKDVDILIVNCSLFSPTPSLSAMVINKYKLRSNIKSFNLSGMGCSAGLISVDLARDLLQVHPNSNAIIVSTEIITPNYYQGNERAMLLPNCLFRMGAAAIHMSNRRSDRWRAKYKLSHLVRTHRGADDKSFYCVYEQEDKEGHVGINLSKDLMAIAGEALKANITTIGPLVLPASEQLLFLTSLIGRKIFNPKWKPYIPDFKLAFEHFCIHAGGRAVIDELQKNLQLSGEHVEASRMTLHRFGNTSSSSLWYELSYIESKGRMRRGDRVWQIAFGSGFKCNSAVWKCNRTIKTPKDGPWSDCIDRYPVFIPEVVKL

Gene Information

Entrez Gene ID
843182
Gene Name
3-ketoacyl-CoA synthase 6
Gene Symbol
KCS6
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IDA:TAIR C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0016747 IEA:InterPro F transferase activity, transferring acyl groups other than amino-acyl groups
GO:0006633 IEA:UniProtKB-UniPathway P fatty acid biosynthetic process
GO:0009409 IEP:TAIR P response to cold
GO:0009416 IEP:TAIR P response to light stimulus
GO:0009826 IMP:TAIR P unidimensional cell growth
GO:0010025 IMP:TAIR P wax biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
ath01110 Biosynthesis of secondary metabolites
ath_M00415 Fatty acid biosynthesis, elongation, endoplasmic reticulum
ath00062 Fatty acid elongation

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY-7036 very long chain fatty acid biosynthesis II

Domain Information

InterPro Annotations

Accession Description
IPR013747 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C-terminal
IPR013601 FAE1/Type III polyketide synthase-like protein
IPR016039 Thiolase-like
IPR016038 Thiolase-like, subgroup
IPR012392 Very-long-chain 3-ketoacyl-CoA synthase

UniProt Annotations

Entry Information

Gene Name
3-ketoacyl-CoA synthase 6
Protein Entry
KCS6_ARATH
UniProt ID
Q9XF43
Species
Arabidopsis

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9XF43-1; Sequence=Displayed; Name=2; IsoId=Q9XF43-2; Sequence=VSP_022340, VSP_022341; Note=Derived from EST data. No experimental confirmation available.;
Catalytic Activity A very-long-chain acyl-CoA + malonyl-CoA = CoA + a very-long-chain 3-oxoacyl-CoA + CO(2). {ECO:0000269|PubMed:10330468}.
Disruption Phenotype Plants have no wax crystals and are male sterile. {ECO:0000269|PubMed:10330468}.
Function Contributes to cuticular wax and suberin biosynthesis. Involved in both decarbonylation and acyl-reduction wax synthesis pathways. Required for elongation of C24 fatty acids, an essential step of the cuticular wax production. {ECO:0000269|PubMed:10330468}.
Induction Repressed by herbicides such as flufenacet and benfuresate. {ECO:0000269|PubMed:12916765}.
Pathway Lipid metabolism; fatty acid biosynthesis.
Ptm Ubiquitinated. {ECO:0000269|PubMed:19292762}.
Sequence Caution Sequence=BAD94789.1; Type=Erroneous initiation; Evidence={ECO:0000305};
Similarity Belongs to the chalcone/stilbene synthases family. {ECO:0000305}.
Similarity Contains 1 FAE (fatty acid elongase) domain. {ECO:0000305}.
Subcellular Location Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.
Tissue Specificity In epidermal cells of aerial tissues. {ECO:0000269|PubMed:10330468}.

Identical and Related Proteins

Unique RefSeq proteins for LMP009706 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15221431 RefSeq NP_177020 497 3-ketoacyl-CoA synthase 6
30697701 RefSeq NP_849861 377 3-ketoacyl-CoA synthase 6

Identical Sequences to LMP009706 proteins

Reference Database Accession Length Protein Name
GI:15221431 GenBank ACW93067.1 497 Sequence 11792 from patent US 7569389
GI:15221431 GenBank ACW94107.1 497 Sequence 13200 from patent US 7569389
GI:15221431 GenBank ACX15705.1 497 Sequence 42570 from patent US 7569389
GI:15221431 GenBank ACX16416.1 497 Sequence 43535 from patent US 7569389
GI:15221431 GenBank ACX19012.1 497 Sequence 47042 from patent US 7569389
GI:15221431 GenBank AEE34804.1 497 3-ketoacyl-CoA synthase 6 [Arabidopsis thaliana]
GI:30697701 GenBank AEE34805.1 377 3-ketoacyl-CoA synthase 6 [Arabidopsis thaliana]

Related Sequences to LMP009706 proteins

Reference Database Accession Length Protein Name
GI:15221431 EMBL CAW45968.1 497 unnamed protein product [Arabidopsis thaliana]
GI:15221431 EMBL CAW71228.1 497 unnamed protein product [Arabidopsis thaliana]
GI:15221431 EMBL CBC11470.1 497 unnamed protein product [Arabidopsis thaliana]
GI:15221431 EMBL CBC60959.1 497 unnamed protein product [Arabidopsis thaliana]
GI:30697701 GenBank AAE79646.1 497 Sequence 4 from patent US 6274790
GI:15221431 GenBank AAE84926.1 500 Sequence 12 from patent US 6307128
GI:30697701 GenBank AAE84926.1 500 Sequence 12 from patent US 6307128
GI:15221431 GenBank AAM16230.1 497 At1g68530/T26J14_10 [Arabidopsis thaliana]
GI:30697701 GenBank ACW93067.1 497 Sequence 11792 from patent US 7569389
GI:30697701 GenBank ACW94107.1 497 Sequence 13200 from patent US 7569389
GI:30697701 RefSeq NP_177020.1 497 3-ketoacyl-CoA synthase 6 [Arabidopsis thaliana]
GI:30697701 SwissProt Q9XF43.1 497 RecName: Full=3-ketoacyl-CoA synthase 6; Short=KCS-6; AltName: Full=Cuticular protein 1; AltName: Full=Very long-chain fatty acid condensing enzyme 6; Short=VLCFA condensing enzyme 6 [Arabidopsis thaliana]