Gene/Proteome Database (LMPD)

LMPD ID
LMP009711
Gene ID
817876
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
3-ketoacyl-CoA thiolase 2
Gene Symbol
PKT3
Synonyms
3-KETOACYL-COA THIOLASE 2; KAT2; PED1; peroxisomal 3-ketoacyl-CoA thiolase 3; PEROXISOME DEFECTIVE 1; PKT3; potassium channel in Arabidopsis thaliana 2
Alternate Names
3-ketoacyl-CoA thiolase 2
Chromosome
2
EC Number
2.3.1.16
Summary
Encodes an organellar (peroxisome, glyoxysome) 3-ketoacyl-CoA thiolase, involved in fatty acid b-oxidation during germination and subsequent seedling growth. Mutants have defects in glyoxysomal fatty acid beta-oxidation. EC2.3.1.16 thiolase.
Orthologs
View orthologs and multiple alignments for PKT3

Proteins

3-ketoacyl-CoA thiolase 2
Refseq ID NP_180873
Protein GI 15225798
UniProt ID Q56WD9
mRNA ID NM_128874
Length 462
RefSeq Status REVIEWED
MEKAIERQRVLLEHLRPSSSSSHNYEASLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTPLCKSKRGNFKDTYPDDLLAPVLRALIEKTNLNPSEVGDIVVGTVLAPGSQRASECRMAAFYAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVNPAVKKFAQAQNCLLPMGVTSENVAQRFGVSRQEQDQAAVDSHRKAAAATAAGKFKDEIIPVKTKLVDPKTGDEKPITVSVDDGIRPTTTLASLGKLKPVFKKDGTTTAGNSSQVSDGAGAVLLMKRSVAMQKGLPVLGVFRTFAAVGVDPAIMGIGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARKVEAQGLLSKDAR

Gene Information

Entrez Gene ID
817876
Gene Name
3-ketoacyl-CoA thiolase 2
Gene Symbol
PKT3
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0009507 IDA:TAIR C chloroplast
GO:0009514 IEA:UniProtKB-KW C glyoxysome
GO:0016020 IDA:TAIR C membrane
GO:0005739 IDA:TAIR C mitochondrion
GO:0005730 IDA:TAIR C nucleolus
GO:0005777 IDA:TAIR C peroxisome
GO:0005774 IDA:TAIR C vacuolar membrane
GO:0003988 IDA:TAIR F acetyl-CoA C-acyltransferase activity
GO:0006635 TAS:TAIR P fatty acid beta-oxidation
GO:0010111 IMP:TAIR P glyoxysome organization
GO:0009695 NAS:TAIR P jasmonic acid biosynthetic process
GO:0031408 IEA:UniProtKB-KW P oxylipin biosynthetic process
GO:0009789 IMP:TAIR P positive regulation of abscisic acid-activated signaling pathway
GO:0009611 NAS:TAIR P response to wounding

KEGG Pathway Links

KEGG Pathway ID Description
ath04146 Peroxisome
ath_M00087 beta-Oxidation

Domain Information

InterPro Annotations

Accession Description
IPR002155 Thiolase
IPR020617 Thiolase, C-terminal
IPR020616 Thiolase, N-terminal
IPR020610 Thiolase, active site
IPR020615 Thiolase, acyl-enzyme intermediate active site
IPR020613 Thiolase, conserved site
IPR016039 Thiolase-like
IPR016038 Thiolase-like, subgroup

UniProt Annotations

Entry Information

Gene Name
3-ketoacyl-CoA thiolase 2
Protein Entry
THIK2_ARATH
UniProt ID
Q56WD9
Species
Arabidopsis

Comments

Comment Type Description
Biophysicochemical Properties Kinetic parameters: KM=77.5 uM for acetoacetyl-CoA (at 25 degrees Celsius) {ECO:0000269|PubMed:11696182}; Vmax=5000 nmol/min/mg enzyme (at 25 degrees Celsius) {ECO:0000269|PubMed:11696182};
Catalytic Activity Acyl-CoA + acetyl-CoA = CoA + 3-oxoacyl-CoA.
Developmental Stage Levels increase strongly upon imbibition and decrease 3 days later. Strongly induced in leaves during senescence. {ECO:0000269|PubMed:11356168, ECO:0000269|PubMed:11696182, ECO:0000269|PubMed:11891244}.
Function Involved in long chain fatty-acid beta-oxidation prior to gluconeogenesis during germination and subsequent seedling growth. Confers sensitivity to 2,4-dichlorophenoxybutiric acid (2,4-DB). Required for local and systemic induction of jasmonic acid (JA) biosynthesis after wounding. Seems to be involved in JA biosynthesis during senescence. {ECO:0000269|PubMed:11696182, ECO:0000269|PubMed:11891244, ECO:0000269|PubMed:15141068, ECO:0000269|PubMed:15979881, ECO:0000269|PubMed:9490742}.
Induction Expressed in the dark, repressed by light (at protein level). Induced by dehydration, by abscisic acid (ABA) and by wounding, both locally and systemically. {ECO:0000269|PubMed:10212254, ECO:0000269|PubMed:15141068, ECO:0000269|PubMed:9490742}.
Pathway Lipid metabolism; fatty acid metabolism.
Sequence Caution Sequence=AAL25590.1; Type=Frameshift; Positions=375; Evidence={ECO:0000305};
Similarity Belongs to the thiolase family. {ECO:0000305}.
Subcellular Location Peroxisome. Glyoxysome. Note=Peroxisomal targeting signal type 2 (PTS2-type) import is temperature and ATP- dependent, induced by zinc ions and PTS1-type import, but repressed by mature forms of PED1.
Subunit Homodimer. {ECO:0000269|PubMed:16630629}.
Tissue Specificity Accumulates in etiolated cotyledons and in seedlings, also present in roots, flowers and siliques (at protein level). High levels in wounded leaves. {ECO:0000269|PubMed:10212254, ECO:0000269|PubMed:11696182, ECO:0000269|PubMed:15141068, ECO:0000269|PubMed:9490742}.

Identical and Related Proteins

Unique RefSeq proteins for LMP009711 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15225798 RefSeq NP_180873 462 3-ketoacyl-CoA thiolase 2

Identical Sequences to LMP009711 proteins

Reference Database Accession Length Protein Name
GI:15225798 GenBank AAM65085.1 462 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
GI:15225798 GenBank AAO00647.1 462 Sequence 12 from patent US 6489461
GI:15225798 GenBank ACW87707.1 462 Sequence 4505 from patent US 7569389
GI:15225798 GenBank ADT59956.1 462 Sequence 802 from patent US 7847156
GI:15225798 GenBank AEC08791.1 462 3-ketoacyl-CoA thiolase 2 [Arabidopsis thaliana]
GI:15225798 SwissProt Q56WD9.2 462 RecName: Full=3-ketoacyl-CoA thiolase 2, peroxisomal; AltName: Full=Acetyl-CoA acyltransferase 2; AltName: Full=Beta-ketothiolase 2; AltName: Full=Peroxisomal 3-oxoacyl-CoA thiolase 2; AltName: Full=Peroxisome defective protein 1; Flags: Precursor [Arabidopsis thaliana]

Related Sequences to LMP009711 proteins

Reference Database Accession Length Protein Name
GI:15225798 DBBJ BAJ34444.1 462 unnamed protein product [Eutrema halophilum]
GI:15225798 GenBank EFH57524.1 462 hypothetical protein ARALYDRAFT_482251 [Arabidopsis lyrata subsp. lyrata]
GI:15225798 GenBank ESQ51904.1 462 hypothetical protein EUTSA_v10016622mg [Eutrema salsugineum]
GI:15225798 RefSeq XP_002881265.1 462 hypothetical protein ARALYDRAFT_482251 [Arabidopsis lyrata subsp. lyrata]
GI:15225798 RefSeq XP_006410451.1 462 hypothetical protein EUTSA_v10016622mg [Eutrema salsugineum]
GI:15225798 RefSeq XP_010469514.1 462 PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Camelina sativa]