Gene/Proteome Database (LMPD)

LMPD ID
LMP009714
Gene ID
832040
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
3-ketodihydrosphinganine reductase-like protein
Gene Symbol
AT5G19200
Synonyms
T24G5.100; T24G5_100
Alternate Names
3-ketodihydrosphinganine reductase-like protein
Chromosome
5
EC Number
1.1.1.102

Proteins

3-ketodihydrosphinganine reductase-like protein
Refseq ID NP_197421
Protein GI 15239681
UniProt ID F4JZN6
mRNA ID NM_121925
Length 331
RefSeq Status REVIEWED
MAAIFSLFLFFILFIVSLLIILSFIVRPRSVTIPIKFRHVFITGGSSGIGLALAHRAVSEGAKVSILARSTEKLAEAKRSIQLATGVEVATFSADVRDYDAVSKAIDESGPIDVLIVNQGVFIGKELEKQSPEEVKFMIDVNLTGSFNVIKAALPAMKAREGRGPASISLVSSQAGQAGIYGYTAYSASKFGLQGLAQALQQEVISDGIHVTLLFPPDTDTPGFEQELKKRPELTSIIAASSGSMKTNEVAKICFDGIKAGKFTVTCHFIGFLLSIASTGMSPQGSFWLALTEVMFGGLIRLASLVFQWQWYKTIEKWSQRNKKEVNSKLA

Gene Information

Entrez Gene ID
832040
Gene Name
3-ketodihydrosphinganine reductase-like protein
Gene Symbol
AT5G19200
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005789 IDA:TAIR C endoplasmic reticulum membrane
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0047560 IDA:TAIR F 3-dehydrosphinganine reductase activity
GO:0030148 IMP:TAIR P sphingolipid biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
ath01100 Metabolic pathways
ath00600 Sphingolipid metabolism

REACTOME Pathway Links

REACTOME Pathway ID Description
6254191 Sphingolipid de novo biosynthesis
6254192 Sphingolipid metabolism

Domain Information

InterPro Annotations

Accession Description
IPR002347 Glucose/ribitol dehydrogenase
IPR016040 NAD(P)-binding domain
IPR002198 Short-chain dehydrogenase/reductase SDR
IPR020904 Short-chain dehydrogenase/reductase, conserved site

UniProt Annotations

Entry Information

Gene Name
3-ketodihydrosphinganine reductase-like protein
Protein Entry
TC10B_ARATH
UniProt ID
F4JZN6
Species
Arabidopsis

Comments

Comment Type Description
Catalytic Activity Sphinganine + NADP(+) = 3-dehydrosphinganine + NADPH. {ECO:0000269|PubMed:21421810}.
Disruption Phenotype No visible phenotype under normal growth conditions, but the double mutants tsc10a and tsc10b are not viable. {ECO:0000269|PubMed:21421810}.
Function Catalyzes the reduction of 3-ketodihydrosphingosine (KDS) to dihydrosphingosine (DHS). Required for sphingolipid biosynthesis. In plants, sphingolipids seems to play a critical role in mineral ion homeostasis, most likely through their involvement in the ion transport functionalities of membrane systems in the root. Is stereospecific for D-erythro-DHS production and does not produce L-threo-DHS. {ECO:0000269|PubMed:21421810}.
Pathway Lipid metabolism; sphingolipid metabolism.
Similarity Belongs to the short-chain dehydrogenases/reductases (SDR) family. {ECO:0000305}.
Subcellular Location Endoplasmic reticulum membrane {ECO:0000305|PubMed:21421810}; Multi-pass membrane protein {ECO:0000305|PubMed:21421810}.
Tissue Specificity Expressed in roots, leaves, stems and flowers. {ECO:0000269|PubMed:21421810}.

Identical and Related Proteins

Unique RefSeq proteins for LMP009714 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15239681 RefSeq NP_197421 331 3-ketodihydrosphinganine reductase-like protein

Identical Sequences to LMP009714 proteins

Reference Database Accession Length Protein Name
GI:15239681 gnl TAIR 331 3-ketodihydrosphinganine reductase-like protein [Arabidopsis thaliana]
GI:15239681 SwissProt F4JZN6.1 331 RecName: Full=3-dehydrosphinganine reductase TSC10B; AltName: Full=3-ketodihydrosphingosine reductase; Short=KDS reductase; AltName: Full=3-ketosphinganine reductase [Arabidopsis thaliana]

Related Sequences to LMP009714 proteins

Reference Database Accession Length Protein Name
GI:15239681 DBBJ BAF00257.1 326 hypothetical protein [Arabidopsis thaliana]
GI:15239681 GenBank AAF66134.1 327 unknown protein; 15741-13972 [Arabidopsis thaliana]
GI:15239681 GenBank AAO24564.1 327 At3g06060 [Arabidopsis thaliana]
GI:15239681 GenBank EOA21099.1 327 hypothetical protein CARUB_v10001439mg [Capsella rubella]
GI:15239681 RefSeq XP_006288201.1 327 hypothetical protein CARUB_v10001439mg [Capsella rubella]
GI:15239681 SwissProt Q0WRJ2.1 326 RecName: Full=3-dehydrosphinganine reductase TSC10A; AltName: Full=3-ketodihydrosphingosine reductase; Short=KDS reductase; AltName: Full=3-ketosphinganine reductase [Arabidopsis thaliana]