Gene/Proteome Database (LMPD)
Proteins
| 3-oxo-5-alpha-steroid 4-dehydrogenase family protein | |
|---|---|
| Refseq ID | NP_197105 |
| Protein GI | 15237245 |
| UniProt ID | Q9LFS3 |
| mRNA ID | NM_121606 |
| Length | 268 |
| RefSeq Status | REVIEWED |
| MEMVTSFVYPPPPSILLNCMSVVGVAALANIGWSEIRGNHLKYSKFGVSSSSPQPQKERFGSISSRNGMLLLYTPAFLAAASSFFVVPSDDLRFLLLKSALALHFFKRVFEVLFIHKYSGGMAIDSALTISSSYFSSTALMLYSQNLTLGLTEPSFDMKLAGVVMFVVGIVGNLYHHVLLAKLRKEDGKKEYKIPKGGLFDIIICPHYLFEILVFWSFFLISQTIYSFSFAMGTMLYLIGRSYATRTWYLSKFDDFPKHIKALIPFVF | |
Gene Information
Entrez Gene ID
Gene Name
3-oxo-5-alpha-steroid 4-dehydrogenase family protein
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0009507 | IDA:TAIR | C | chloroplast |
| GO:0009941 | IDA:TAIR | C | chloroplast envelope |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0016627 | IEA:InterPro | F | oxidoreductase activity, acting on the CH-CH group of donors |
| GO:0006629 | IEA:InterPro | P | lipid metabolic process |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR001104 | 3-oxo-5-alpha-steroid 4-dehydrogenase, C-terminal |
UniProt Annotations
Entry Information
Gene Name
3-oxo-5-alpha-steroid 4-dehydrogenase family protein
Protein Entry
Q9LFS3_ARATH
UniProt ID
Species
Arabidopsis
Identical and Related Proteins
Unique RefSeq proteins for LMP009716 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 15237245 | RefSeq | NP_197105 | 268 | 3-oxo-5-alpha-steroid 4-dehydrogenase family protein |
Identical Sequences to LMP009716 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15237245 | EMBL | CAC01800.1 | 268 | steroid 5alpha-reductase-like protein [Arabidopsis thaliana] |
| GI:15237245 | GenBank | AAK55737.1 | 268 | AT5g16010/F1N13_150 [Arabidopsis thaliana] |
| GI:15237245 | GenBank | AAN64521.1 | 268 | At5g16010/F1N13_150 [Arabidopsis thaliana] |
| GI:15237245 | gnl | TAIR | 268 | 3-oxo-5-alpha-steroid 4-dehydrogenase family protein [Arabidopsis thaliana] |
Related Sequences to LMP009716 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15237245 | GenBank | EFH47957.1 | 265 | 3-oxo-5-alpha-steroid 4-dehydrogenase family protein [Arabidopsis lyrata subsp. lyrata] |
| GI:15237245 | RefSeq | XP_002871698.1 | 265 | 3-oxo-5-alpha-steroid 4-dehydrogenase family protein [Arabidopsis lyrata subsp. lyrata] |
| GI:15237245 | RefSeq | XP_006288454.1 | 269 | hypothetical protein CARUB_v10001715mg [Capsella rubella] |
| GI:15237245 | RefSeq | XP_010453749.1 | 274 | PREDICTED: steroid 5-alpha-reductase DET2-like [Camelina sativa] |
| GI:15237245 | RefSeq | XP_010492472.1 | 272 | PREDICTED: very-long-chain enoyl-CoA reductase-like [Camelina sativa] |
| GI:15237245 | RefSeq | XP_010492473.1 | 272 | PREDICTED: very-long-chain enoyl-CoA reductase-like [Camelina sativa] |