Gene/Proteome Database (LMPD)
Proteins
| 3-oxoacyl-[acyl-carrier-protein] reductase | |
|---|---|
| Refseq ID | NP_564216 |
| Protein GI | 18395461 |
| UniProt ID | P33207 |
| mRNA ID | NM_102282 |
| Length | 319 |
| RefSeq Status | REVIEWED |
| MAAAVAAPRLISLKAVAKLGFREISQIRQLAPLHSAIPHFGMLRCRSRQPFSTSVVKAQATATEQSPGEVVQKVESPVVVITGASRGIGKAIALALGKAGCKVLVNYARSAKEAEEVAKQIEEYGGQAITFGGDVSKATDVDAMMKTALDKWGTIDVVVNNAGITRDTLLIRMKQSQWDEVIALNLTGVFLCTQAAVKIMMKKKRGRIINISSVVGLIGNIGQANYAAAKGGVISFSKTAAREGASRNINVNVVCPGFIASDMTAELGEDMEKKILGTIPLGRYGKAEEVAGLVEFLALSPAASYITGQAFTIDGGIAI | |
Gene Information
Entrez Gene ID
Gene Name
3-oxoacyl-[acyl-carrier-protein] reductase
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0009507 | IDA:TAIR | C | chloroplast |
| GO:0009941 | IDA:TAIR | C | chloroplast envelope |
| GO:0009570 | IDA:TAIR | C | chloroplast stroma |
| GO:0009536 | IDA:TAIR | C | plastid |
| GO:0004316 | ISS:TAIR | F | 3-oxoacyl-[acyl-carrier-protein] reductase (NADPH) activity |
| GO:0051287 | IEA:InterPro | F | NAD binding |
| GO:0005507 | IDA:TAIR | F | copper ion binding |
| GO:0006633 | IEA:UniProtKB-UniPathway | P | fatty acid biosynthetic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ath01040 | Biosynthesis of unsaturated fatty acids |
| ath00780 | Biotin metabolism |
| ath00061 | Fatty acid biosynthesis |
| ath_M00083 | Fatty acid biosynthesis, elongation |
Domain Information
UniProt Annotations
Entry Information
Gene Name
3-oxoacyl-[acyl-carrier-protein] reductase
Protein Entry
FABG_ARATH
UniProt ID
Species
Arabidopsis
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | (3R)-3-hydroxyacyl-[acyl-carrier-protein] + NADP(+) = 3-oxoacyl-[acyl-carrier-protein] + NADPH. |
| Pathway | Lipid metabolism; fatty acid biosynthesis. |
| Sequence Caution | Sequence=AAC00590.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; Sequence=AAF97951.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; |
| Similarity | Belongs to the short-chain dehydrogenases/reductases (SDR) family. {ECO:0000305}. |
| Subcellular Location | Plastid, chloroplast. Plastid. Note=And non- photosynthetic plastids. |
| Subunit | Homotetramer. {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP009717 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 18395461 | RefSeq | NP_564216 | 319 | 3-oxoacyl-[acyl-carrier-protein] reductase |
Identical Sequences to LMP009717 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:18395461 | EMBL | CBF61721.1 | 319 | unnamed protein product [Arabidopsis thaliana] |
| GI:18395461 | EMBL | CBU86597.1 | 319 | unnamed protein product [Arabidopsis thaliana] |
| GI:18395461 | GenBank | ACX16705.1 | 319 | Sequence 43925 from patent US 7569389 |
| GI:18395461 | GenBank | ADT59900.1 | 319 | Sequence 690 from patent US 7847156 |
| GI:18395461 | GenBank | AEE30522.1 | 319 | 3-oxoacyl-[acyl-carrier-protein] reductase [Arabidopsis thaliana] |
| GI:18395461 | GenBank | AGX53482.1 | 319 | Sequence 7333 from patent US 8541208 |
Related Sequences to LMP009717 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:18395461 | EMBL | CAA45794.1 | 319 | 3-oxoacyl-[acyl-carrier protein] reductase [Arabidopsis thaliana] |
| GI:18395461 | GenBank | AAF97951.1 | 308 | F21J9.2 [Arabidopsis thaliana] |
| GI:18395461 | GenBank | EFH69712.1 | 319 | chloroplast 3-oxoacyl-(acyl-carrier protein) reductase [Arabidopsis lyrata subsp. lyrata] |
| GI:18395461 | GenBank | EOA38281.1 | 319 | hypothetical protein CARUB_v10009774mg [Capsella rubella] |
| GI:18395461 | RefSeq | XP_002893453.1 | 319 | chloroplast 3-oxoacyl-(acyl-carrier protein) reductase [Arabidopsis lyrata subsp. lyrata] |
| GI:18395461 | RefSeq | XP_006305383.1 | 319 | hypothetical protein CARUB_v10009774mg [Capsella rubella] |