Gene/Proteome Database (LMPD)
Proteins
acetyl-CoA carboxylase beta subunit (chloroplast) | |
---|---|
Refseq ID | NP_051068 |
Protein GI | 7525042 |
UniProt ID | P56765 |
mRNA ID | 0 |
Length | 488 |
RefSeq Status | REVIEWED |
MEKSWFNFMFSKGELEYRGELSKAMDSFAPGEKTTISQDRFIYDMDKNFYGWDERSSYSSSYSNNVDLLVSSKDIRNFISDDTFFVRDSNKNSYSIFFDKKKKIFEIDNDFSDLEKFFYSYCSSSYLNNRSKGDNDLHYDPYIKDTKYNCTNHINSCIDSYFRSYICIDNNFLIDSNNFNESYIYNFICSESGKIRESKNYKIRTNRNRSNLISSKDFDITQNYNQLWIQCDNCYGLMYKKVKMNVCEQCGHYLKMSSSERIELSIDPGTWNPMDEDMVSADPIKFHSKEEPYKNRIDSAQKTTGLTDAVQTGTGQLNGIPVALGVMDFRFMGGSMGSVVGEKITRLIEYATNQCLPLILVCSSGGARMQEGSLSLMQMAKISSVLCDYQSSKKLFYISILTSPTTGGVTASFGMLGDIIIAEPYAYIAFAGKRVIEQTLKKAVPEGSQAAESLLRKGLLDAIVPRNLLKGVLSELFQLHAFFPLNTN |
Gene Information
Entrez Gene ID
Gene Name
acetyl-CoA carboxylase beta subunit
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0009317 | IEA:InterPro | C | acetyl-CoA carboxylase complex |
GO:0009570 | IEA:UniProtKB-HAMAP | C | chloroplast stroma |
GO:0016020 | IEA:UniProtKB-KW | C | membrane |
GO:0003989 | IEA:UniProtKB-HAMAP | F | acetyl-CoA carboxylase activity |
GO:0005524 | IEA:UniProtKB-KW | F | ATP binding |
GO:0008270 | IEA:UniProtKB-HAMAP | F | zinc ion binding |
GO:0006633 | IEA:UniProtKB-HAMAP | P | fatty acid biosynthetic process |
GO:2001295 | IEA:UniProtKB-UniPathway | P | malonyl-CoA biosynthetic process |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
ath01200 | Carbon metabolism |
ath00061 | Fatty acid biosynthesis |
ath_M00082 | Fatty acid biosynthesis, initiation |
ath00620 | Pyruvate metabolism |
Domain Information
UniProt Annotations
Entry Information
Gene Name
acetyl-CoA carboxylase beta subunit
Protein Entry
ACCD_ARATH
UniProt ID
Species
Arabidopsis
Comments
Comment Type | Description |
---|---|
Catalytic Activity | ATP + acetyl-CoA + HCO(3)(-) = ADP + phosphate + malonyl-CoA. {ECO:0000255|HAMAP-Rule:MF_01395}. |
Cofactor | Name=Zn(2+); Xref=ChEBI:CHEBI:29105; Evidence={ECO:0000255|HAMAP-Rule:MF_01395}; Note=Binds 1 zinc ion per subunit. {ECO:0000255|HAMAP- Rule:MF_01395}; |
Function | Component of the acetyl coenzyme A carboxylase (ACC) complex. Biotin carboxylase (BC) catalyzes the carboxylation of biotin on its carrier protein (BCCP) and then the CO(2) group is transferred by the transcarboxylase to acetyl-CoA to form malonyl- CoA. {ECO:0000255|HAMAP-Rule:MF_01395}. |
Pathway | Lipid metabolism; malonyl-CoA biosynthesis; malonyl-CoA from acetyl-CoA: step 1/1. {ECO:0000255|HAMAP-Rule:MF_01395}. |
Rna Editing | Modified_positions=265 {ECO:0000269|PubMed:11078738}; |
Similarity | Belongs to the AccD/PCCB family. {ECO:0000255|HAMAP- Rule:MF_01395}. |
Subcellular Location | Plastid, chloroplast membrane; Peripheral membrane protein. Plastid, chloroplast stroma. |
Subunit | Acetyl-CoA carboxylase is a heterohexamer composed of biotin carboxyl carrier protein, biotin carboxylase and 2 subunits each of ACCase subunit alpha and ACCase plastid-coded subunit beta (accD). {ECO:0000269|PubMed:10759501}. |
Tissue Specificity | Accumulates in fatty acids synthesizing tissues such as embryos, expanding leaves, flower buds, flowers, and developing siliques. {ECO:0000269|PubMed:10759501}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP009756 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
7525042 | RefSeq | NP_051068 | 488 | acetyl-CoA carboxylase beta subunit (chloroplast) |
Identical Sequences to LMP009756 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:7525042 | DBBJ | BAA84394.1 | 488 | carboxytransferase beta subunit (chloroplast) [Arabidopsis thaliana] |
GI:7525042 | GenBank | AAF35256.1 | 488 | carboxyltransferase beta subunit (chloroplast) [Arabidopsis thaliana] |
GI:7525042 | GenBank | AGD35205.1 | 488 | Sequence 32661 from patent US 8343764 |
Related Sequences to LMP009756 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:7525042 | DBBJ | BAF50206.1 | 484 | carboxytransferase beta subunit (chloroplast) [Capsella bursa-pastoris] |
GI:7525042 | GenBank | EFH63149.1 | 484 | acetyl-CoA carboxylase beta subunit [Arabidopsis lyrata subsp. lyrata] |
GI:7525042 | RefSeq | YP_001123382.1 | 484 | acetyl-CoA carboxylase beta subunit (chloroplast) [Capsella bursa-pastoris] |
GI:7525042 | RefSeq | XP_002886890.1 | 484 | acetyl-CoA carboxylase beta subunit [Arabidopsis lyrata subsp. lyrata] |
GI:7525042 | SwissProt | A4QKK1.1 | 484 | RecName: Full=Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, chloroplastic; Short=ACCase subunit beta; Short=Acetyl-CoA carboxylase carboxyltransferase subunit beta (chloroplast) [Capsella bursa-pastoris] |
GI:7525042 | SwissProt | P56765.2 | 488 | RecName: Full=Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, chloroplastic; Short=ACCase subunit beta; Short=Acetyl-CoA carboxylase carboxyltransferase subunit beta (chloroplast) [Arabidopsis thaliana] |