Gene/Proteome Database (LMPD)
Proteins
acyl carrier protein 3 | |
---|---|
Refseq ID | NP_001078726 |
Protein GI | 145334761 |
UniProt ID | Q9FGJ4 |
mRNA ID | NM_001085257 |
Length | 131 |
RefSeq Status | REVIEWED |
MHCIRSSILQHLRLRVSVRPTSLLQNENGFKSIGIFNFTSEAAADGGQDQILSRVIELVKKYDKTNTSEVTERADFQKDLSLDSLDKTELVMAIEEEFSIEIPDEKADKLTCCGDVATYILSETPTKASES |
Gene Information
Entrez Gene ID
Gene Name
acyl carrier protein 3
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005739 | IEA:UniProtKB-KW | C | mitochondrion |
GO:0070469 | IEA:UniProtKB-KW | C | respiratory chain |
GO:0006633 | IEA:UniProtKB-UniPathway | P | fatty acid biosynthetic process |
GO:0055114 | IEA:UniProtKB-KW | P | oxidation-reduction process |
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Function | Carrier of the growing fatty acid chain in fatty acid biosynthesis (By similarity). May be involved in the synthesis of short and medium chain fatty acids. Accessory and non-catalytic subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which functions in the transfer of electrons from NADH to the respiratory chain (By similarity). {ECO:0000250}. |
Pathway | Lipid metabolism; fatty acid biosynthesis. |
Ptm | 4'-phosphopantetheine is transferred from CoA to a specific serine of the apo-ACP-like protein. {ECO:0000305}. |
Similarity | Contains 1 acyl carrier domain. {ECO:0000305}. |
Subcellular Location | Mitochondrion {ECO:0000250}. |
Subunit | Complex I is composed of at least 49 different subunits. |
Identical and Related Proteins
Unique RefSeq proteins for LMP009764 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
145334761 | RefSeq | NP_001078726 | 131 | acyl carrier protein 3 |
Identical Sequences to LMP009764 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:145334761 | GenBank | AAL36307.1 | 131 | putative acyl carrier protein [Arabidopsis thaliana] |
GI:145334761 | GenBank | AAM20351.1 | 131 | putative acyl carrier protein [Arabidopsis thaliana] |
GI:145334761 | gnl | TAIR | 131 | acyl carrier protein 3 [Arabidopsis thaliana] |
GI:145334761 | gnl | TAIR | 131 | acyl carrier protein 3 [Arabidopsis thaliana] |
GI:145334761 | RefSeq | NP_199574.1 | 131 | acyl carrier protein 3 [Arabidopsis thaliana] |
GI:145334761 | SwissProt | Q9FGJ4.1 | 131 | RecName: Full=Acyl carrier protein 3, mitochondrial; AltName: Full=MtACP-3; Short=ACP; AltName: Full=NADH-ubiquinone oxidoreductase 9.6 kDa subunit; Flags: Precursor [Arabidopsis thaliana] |
Related Sequences to LMP009764 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:145334761 | GenBank | EOA14216.1 | 129 | hypothetical protein CARUB_v10027372mg [Capsella rubella] |
GI:145334761 | GenBank | EOA14217.1 | 129 | hypothetical protein CARUB_v10027372mg [Capsella rubella] |
GI:145334761 | RefSeq | XP_006281318.1 | 129 | hypothetical protein CARUB_v10027372mg [Capsella rubella] |
GI:145334761 | RefSeq | XP_006281319.1 | 129 | hypothetical protein CARUB_v10027372mg [Capsella rubella] |
GI:145334761 | RefSeq | XP_006398461.1 | 194 | hypothetical protein EUTSA_v10001034mg [Eutrema salsugineum] |
GI:145334761 | RefSeq | XP_010441433.1 | 133 | PREDICTED: acyl carrier protein 3, mitochondrial-like [Camelina sativa] |