Gene/Proteome Database (LMPD)

LMPD ID
LMP009765
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
acyl carrier protein 5
Gene Symbol
Synonyms
acyl carrier protein 5; A_TM021B04.6; T21B4.110; T21B4_110
Alternate Names
acyl carrier protein 5
Chromosome
5

Proteins

acyl carrier protein 5
Refseq ID NP_198072
Protein GI 15240461
UniProt ID O04652
mRNA ID NM_122602
Length 139
RefSeq Status REVIEWED
MATSFCSSISMQAPFSATTTRFCLNKQATIFNNEKTNNLSFSLRRLMPARLAVSCAVKQETVEKVSEIVKKQLSLTDDQKVTAGTKFTELGADSLDTVEIVMGLEEEFGITMAEERAKEIATVQQAAELIEELVQEKTA

Gene Information

Entrez Gene ID
Gene Name
acyl carrier protein 5
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0009507 IEA:UniProtKB-KW C chloroplast
GO:0000036 ISS:TAIR F ACP phosphopantetheine attachment site binding involved in fatty acid biosynthetic process

Domain Information

InterPro Annotations

Accession Description
IPR003231 Acyl carrier protein (ACP)
IPR009081 Acyl carrier protein-like
IPR006162 Phosphopantetheine attachment site

UniProt Annotations

Entry Information

Gene Name
acyl carrier protein 5
Protein Entry
ACP5_ARATH
UniProt ID
Species
Arabidopsis

Comments

Comment Type Description
Disruption Phenotype No visible phenotype under normal growth conditions. {ECO:0000269|PubMed:19218086}.
Function Carrier of the growing fatty acid chain in fatty acid biosynthesis. {ECO:0000250}.
Ptm 4'-phosphopantetheine is transferred from CoA to a specific serine of apo-ACP by acpS. This modification is essential for activity because fatty acids are bound in thioester linkage to the sulfhydryl of the prosthetic group (By similarity). {ECO:0000250}.
Similarity Contains 1 acyl carrier domain. {ECO:0000305}.
Subcellular Location Plastid, chloroplast {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP009765 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15240461 RefSeq NP_198072 139 acyl carrier protein 5

Identical Sequences to LMP009765 proteins

Reference Database Accession Length Protein Name
GI:15240461 GenBank AAB61070.1 139 A_TM021B04.6 gene product [Arabidopsis thaliana]
GI:15240461 gnl TAIR 139 acyl carrier protein 5 [Arabidopsis thaliana]
GI:15240461 SwissProt O04652.1 139 RecName: Full=Acyl carrier protein 5, chloroplastic; Flags: Precursor [Arabidopsis thaliana]

Related Sequences to LMP009765 proteins

Reference Database Accession Length Protein Name
GI:15240461 GenBank EFH50661.1 139 hypothetical protein ARALYDRAFT_351774 [Arabidopsis lyrata subsp. lyrata]
GI:15240461 GenBank EOA22788.1 141 hypothetical protein CARUB_v10003505mg [Capsella rubella]
GI:15240461 RefSeq XP_002874402.1 139 hypothetical protein ARALYDRAFT_351774 [Arabidopsis lyrata subsp. lyrata]
GI:15240461 RefSeq XP_006289890.1 141 hypothetical protein CARUB_v10003505mg [Capsella rubella]
GI:15240461 RefSeq XP_009111934.1 138 PREDICTED: acyl carrier protein 5, chloroplastic isoform X2 [Brassica rapa]
GI:15240461 RefSeq XP_010455149.1 141 PREDICTED: acyl carrier protein 5, chloroplastic-like [Camelina sativa]