Gene/Proteome Database (LMPD)
LMPD ID
LMP009804
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
ALA-interacting subunit 1
Gene Symbol
Synonyms
ALA-interacting subunit 1; ALIS1
Alternate Names
ALA-interacting subunit 1
Chromosome
3
Summary
Physically interacts with ALA3, and is required for the phospholipid translocase activity of ALA3.
Orthologs
Proteins
| ALA-interacting subunit 1 | |
|---|---|
| Refseq ID | NP_566435 |
| Protein GI | 18399730 |
| UniProt ID | Q9LTW0 |
| mRNA ID | NM_112110 |
| Length | 350 |
| RefSeq Status | REVIEWED |
| MSSSNTPSSSAAAAGSIDSSAARRNSKRPKYSKFTQQELPACKPILTPGWVISTFLIISVIFIPLGVISLFASQDVVEIVDRYDSACIPLSDRANKVAYIQGTGNKSCTRTLIVPKRMKQPIYVYYQLENFYQNHRRYVKSRSDSQLRSVKDENQIDACKPEDDFGGQPIVPCGLIAWSLFNDTYVLSRNNQGLTVNKKGIAWKSDKEHKFGKNVFPKNFQKGNLTGGASLDPNKPLSDQEDLIVWMRTAALPTFRKLYGKIESDLEKGENIQVTLQNNYNTYSFSGKKKLVLSTTSWLGGKNDFLGIAYLTVGGICFVLALAFTVMYLVKPRRLGDPTYLSWNRIPGGR | |
Gene Information
Entrez Gene ID
Gene Name
ALA-interacting subunit 1
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005794 | IDA:TAIR | C | Golgi apparatus |
| GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0015914 | IDA:TAIR | P | phospholipid transport |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR005045 | CDC50/LEM3 family |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Function | Required for the lipid transport activity of the ALA/ALIS P4-ATPase complex. {ECO:0000269|PubMed:18344284, ECO:0000269|PubMed:20053675}. |
| Similarity | Belongs to the CDC50/LEM3 family. {ECO:0000305}. |
| Subcellular Location | Golgi apparatus membrane; Multi-pass membrane protein. Prevacuolar compartment membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. Note=In a heterologous system, the final intracellular localization after exit from the endoplasmic reticulum is the prevacuolar compartment in the presence of ALA2 and the Golgi in the presence of ALA3. |
| Subunit | Associates with ALA3 to form a stable complex. Interacts with ALA2 in a heterologous system. {ECO:0000269|PubMed:18344284, ECO:0000269|PubMed:20053675}. |
| Tissue Specificity | Expressed in roots, leaves, stems, flowers and siliques. Found in petals and sepals, but not in reproductive tissues. In siliques, detected in the upper part of the seed pod and in the area between the seed pod and the stem, but not in developing seeds. Strong expression in vascular shoot tissues and in stomatal guard cells of young rosettes leaves. In roots, expressed in cells surrounding the xylem and in central and peripheral columella cells. {ECO:0000269|PubMed:18344284}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP009804 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 18399730 | RefSeq | NP_566435 | 350 | ALA-interacting subunit 1 |
Identical Sequences to LMP009804 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:18399730 | GenBank | AAK95295.1 | 350 | AT3g12740/MBK21_10 [Arabidopsis thaliana] |
| GI:18399730 | GenBank | AAM14149.1 | 350 | unknown protein [Arabidopsis thaliana] |
| GI:18399730 | GenBank | AAM65148.1 | 350 | unknown [Arabidopsis thaliana] |
| GI:18399730 | GenBank | AEE75241.1 | 350 | ALA-interacting subunit 1 [Arabidopsis thaliana] |
| GI:18399730 | GenBank | AEL85627.1 | 350 | Sequence 1599 from patent US 7989676 |
| GI:18399730 | SwissProt | Q9LTW0.1 | 350 | RecName: Full=ALA-interacting subunit 1; Short=AtALIS1; AltName: Full=ALA3 beta-subunit 1 [Arabidopsis thaliana] |
Related Sequences to LMP009804 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:18399730 | GenBank | EFH59046.1 | 351 | LEM3 (ligand-effect modulator 3) family protein [Arabidopsis lyrata subsp. lyrata] |
| GI:18399730 | RefSeq | XP_002882787.1 | 351 | LEM3 (ligand-effect modulator 3) family protein [Arabidopsis lyrata subsp. lyrata] |
| GI:18399730 | RefSeq | XP_006298037.1 | 349 | hypothetical protein CARUB_v10014082mg [Capsella rubella] |
| GI:18399730 | RefSeq | XP_010499430.1 | 350 | PREDICTED: ALA-interacting subunit 1 [Camelina sativa] |
| GI:18399730 | RefSeq | XP_010465053.1 | 351 | PREDICTED: ALA-interacting subunit 1-like [Camelina sativa] |
| GI:18399730 | RefSeq | XP_010487000.1 | 350 | PREDICTED: ALA-interacting subunit 1-like [Camelina sativa] |