Gene/Proteome Database (LMPD)
Proteins
aldo-keto reductase family 4 member C8 | |
---|---|
Refseq ID | NP_001078019 |
Protein GI | 145330687 |
UniProt ID | O80944 |
mRNA ID | NM_001084550 |
Length | 290 |
RefSeq Status | REVIEWED |
MAAPIRFFELNTGAKLPCVGLGTYAMVATAIEQAIKIGYRHIDCASIYGNEKEIGGVLKKLIGDGFVKREELFITSKLWSNDHLPEDVPKALEKTLQDLQIDYVDLYLIHWPASLKKESLMPTPEMLTKPDITSTWKAMEALYDSGKARAIGVSNFSSKKLTDLLNVARVTPAVNQVECHPVWQQQGLHELCKSKGVHLSGYSPLGSQSKGEVRLKVLQNPIVTEVAEKLGKTTAQVALRWGLQTGHSVLPKSSSGARLKENLDVFDWSIPEDLFTKFSNIPQAKVLPSY |
aldo-keto reductase family 4 member C8 | |
---|---|
Refseq ID | NP_973627 |
Protein GI | 42571107 |
UniProt ID | O80944 |
mRNA ID | NM_201898 |
Length | 290 |
RefSeq Status | REVIEWED |
MAAPIRFFELNTGAKLPCVGLGTYAMVATAIEQAIKIGYRHIDCASIYGNEKEIGGVLKKLIGDGFVKREELFITSKLWSNDHLPEDVPKALEKTLQDLQIDYVDLYLIHWPASLKKESLMPTPEMLTKPDITSTWKAMEALYDSGKARAIGVSNFSSKKLTDLLNVARVTPAVNQVECHPVWQQQGLHELCKSKGVHLSGYSPLGSQSKGEVRLKVLQNPIVTEVAEKLGKTTAQVALRWGLQTGHSVLPKSSSGARLKENLDVFDWSIPEDLFTKFSNIPQAKVLPSY |
aldo-keto reductase family 4 member C8 | |
---|---|
Refseq ID | NP_001118465 |
Protein GI | 186506243 |
UniProt ID | O80944 |
mRNA ID | NM_001124993 |
Length | 291 |
RefSeq Status | REVIEWED |
MAAPIRFFELNTGAKLPCVGLGTYAMVATAIEQAIKIGYRHIDCASIYGNEKEIGGVLKKLIGDGFVKREELFITSKLWSNDHLPEDVPKALEKTLQDLQIDYVDLYLIHWPASLKKESLMPTPEMLTKPDITSTWKAMEALYDSGKARAIGVSNFSSKKLTDLLNVARVTPAVNQVECHPVWQQQGLHELCKSKGVHLSGYSPLGSQSKGEVRLKVLQNPIVTEVAEKLGKTTAQVALRWGLQTGHSVLPKSSSGARLKENLDVFDWSIPEDLFTKFSNIPQAREVLPSY |
aldo-keto reductase family 4 member C8 | |
---|---|
Refseq ID | NP_565871 |
Protein GI | 18404526 |
UniProt ID | O80944 |
mRNA ID | NM_129332 |
Length | 311 |
RefSeq Status | REVIEWED |
MAAPIRFFELNTGAKLPCVGLGTYAMVATAIEQAIKIGYRHIDCASIYGNEKEIGGVLKKLIGDGFVKREELFITSKLWSNDHLPEDVPKALEKTLQDLQIDYVDLYLIHWPASLKKESLMPTPEMLTKPDITSTWKAMEALYDSGKARAIGVSNFSSKKLTDLLNVARVTPAVNQVECHPVWQQQGLHELCKSKGVHLSGYSPLGSQSKGEVRLKVLQNPIVTEVAEKLGKTTAQVALRWGLQTGHSVLPKSSSGARLKENLDVFDWSIPEDLFTKFSNIPQEKFCRATEFAHETHGFYKTIEELWDGEI |
Gene Information
Entrez Gene ID
Gene Name
aldo-keto reductase family 4 member C8
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005829 | IDA:TAIR | C | cytosol |
GO:0070401 | IDA:UniProtKB | F | NADP+ binding |
GO:0004033 | IDA:UniProtKB | F | aldo-keto reductase (NADP) activity |
GO:0016229 | IDA:UniProtKB | F | steroid dehydrogenase activity |
GO:0055114 | IDA:TAIR | P | oxidation-reduction process |
GO:0046686 | IEP:TAIR | P | response to cadmium ion |
GO:0009409 | IEP:UniProtKB | P | response to cold |
GO:0009651 | IEP:UniProtKB | P | response to salt stress |
GO:0009636 | IEA:UniProtKB-KW | P | response to toxic substance |
GO:0009414 | IEP:UniProtKB | P | response to water deprivation |
BIOCYC Pathway Links
BIOCYC Pathway ID | Description |
---|---|
PWY-5453 | methylglyoxal degradation III |
Domain Information
UniProt Annotations
Entry Information
Gene Name
aldo-keto reductase family 4 member C8
Protein Entry
AKRC8_ARATH
UniProt ID
Species
Arabidopsis
Comments
Comment Type | Description |
---|---|
Alternative Products | Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=O80944-1; Sequence=Displayed; Name=2; IsoId=O80944-2; Sequence=VSP_040012, VSP_040015; Note=Derived from EST data. No experimental confirmation available.; Name=3; IsoId=O80944-3; Sequence=VSP_040013, VSP_040014; Note=Derived from EST data. No experimental confirmation available.; |
Biophysicochemical Properties | Kinetic parameters: KM=4.4 uM for 9,10-phenanthrenequinone {ECO:0000269|PubMed:19616008}; KM=35 uM for isatin {ECO:0000269|PubMed:19616008}; KM=1.6 mM for glyoxal {ECO:0000269|PubMed:19616008}; KM=3.3 mM for methylglyoxal {ECO:0000269|PubMed:19616008}; KM=22.4 mM for glyceraldehyde {ECO:0000269|PubMed:19616008}; |
Function | Oxidoreductase acting on a broad range of substrates: reduces ketosteroids, aromatic aldehydes, ketones, sugars and other aliphatic aldehydes, and oxidizes hydroxysteroids. May function as detoxifiying enzyme by reducing a range of toxic aldehydes and ketones produced during stress. {ECO:0000269|PubMed:19616008}. |
Induction | By drought, salt and cold stresses. {ECO:0000269|PubMed:19616008}. |
Similarity | Belongs to the aldo/keto reductase family. {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP009809 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
18404526 | RefSeq | NP_565871 | 311 | aldo-keto reductase family 4 member C8 |
186506243 | RefSeq | NP_001118465 | 291 | aldo-keto reductase family 4 member C8 |
145330687 | RefSeq | NP_001078019 | 290 | aldo-keto reductase family 4 member C8 |
42571107 | RefSeq | NP_973627 | 290 | aldo-keto reductase family 4 member C8 |
Identical Sequences to LMP009809 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:18404526 | GenBank | ABH07514.1 | 311 | aldo-keto reductase [Arabidopsis thaliana] |
GI:18404526 | GenBank | AEC09443.1 | 311 | aldo-keto reductase family 4 member C8 [Arabidopsis thaliana] |
GI:18404526 | GenBank | AEC09444.1 | 311 | aldo-keto reductase family 4 member C8 [Arabidopsis thaliana] |
GI:145330687 | GenBank | AEC09445.1 | 290 | aldo-keto reductase family 4 member C8 [Arabidopsis thaliana] |
GI:42571107 | GenBank | AEC09445.1 | 290 | aldo-keto reductase family 4 member C8 [Arabidopsis thaliana] |
GI:42571107 | GenBank | AEC09446.1 | 290 | aldo-keto reductase family 4 member C8 [Arabidopsis thaliana] |
GI:145330687 | GenBank | AEC09446.1 | 290 | aldo-keto reductase family 4 member C8 [Arabidopsis thaliana] |
GI:186506243 | GenBank | AEC09447.1 | 291 | aldo-keto reductase family 4 member C8 [Arabidopsis thaliana] |
GI:18404526 | GenBank | AEL84870.1 | 311 | Sequence 305 from patent US 7989676 |
GI:145330687 | RefSeq | NP_973627.1 | 290 | aldo-keto reductase family 4 member C8 [Arabidopsis thaliana] |
GI:42571107 | RefSeq | NP_001078019.1 | 290 | aldo-keto reductase family 4 member C8 [Arabidopsis thaliana] |
GI:18404526 | RefSeq | NP_973626.2 | 311 | aldo-keto reductase family 4 member C8 [Arabidopsis thaliana] |
GI:18404526 | RefSeq | XP_004253291.1 | 311 | PREDICTED: aldo-keto reductase family 4 member C8 isoform X1 [Solanum lycopersicum] |
GI:186506243 | RefSeq | XP_010314927.1 | 291 | PREDICTED: aldo-keto reductase family 4 member C8 isoform X2 [Solanum lycopersicum] |
GI:42571107 | RefSeq | XP_010314928.1 | 290 | PREDICTED: aldo-keto reductase family 4 member C8 isoform X3 [Solanum lycopersicum] |
GI:145330687 | RefSeq | XP_010314928.1 | 290 | PREDICTED: aldo-keto reductase family 4 member C8 isoform X3 [Solanum lycopersicum] |
Related Sequences to LMP009809 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:42571107 | GenBank | AAM51246.1 | 311 | putative alcohol dehydrogenase [Arabidopsis thaliana] |
GI:145330687 | GenBank | AAM51246.1 | 311 | putative alcohol dehydrogenase [Arabidopsis thaliana] |
GI:18404526 | GenBank | EFH55966.1 | 311 | aldo/keto reductase family protein [Arabidopsis lyrata subsp. lyrata] |
GI:18404526 | GenBank | AEC09445.1 | 290 | aldo-keto reductase family 4 member C8 [Arabidopsis thaliana] |
GI:186506243 | GenBank | AEC09445.1 | 290 | aldo-keto reductase family 4 member C8 [Arabidopsis thaliana] |
GI:18404526 | GenBank | AEC09446.1 | 290 | aldo-keto reductase family 4 member C8 [Arabidopsis thaliana] |
GI:186506243 | GenBank | AEC09446.1 | 290 | aldo-keto reductase family 4 member C8 [Arabidopsis thaliana] |
GI:145330687 | GenBank | AEC09447.1 | 291 | aldo-keto reductase family 4 member C8 [Arabidopsis thaliana] |
GI:42571107 | GenBank | AEC09447.1 | 291 | aldo-keto reductase family 4 member C8 [Arabidopsis thaliana] |
GI:145330687 | gnl | TIGR | 311 | putative alcohol dehydrogenase [Arabidopsis thaliana] |
GI:42571107 | gnl | TIGR | 311 | putative alcohol dehydrogenase [Arabidopsis thaliana] |
GI:186506243 | gnl | TIGR | 311 | putative alcohol dehydrogenase [Arabidopsis thaliana] |
GI:186506243 | RefSeq | NP_973627.1 | 290 | aldo-keto reductase family 4 member C8 [Arabidopsis thaliana] |
GI:186506243 | RefSeq | NP_001078019.1 | 290 | aldo-keto reductase family 4 member C8 [Arabidopsis thaliana] |
GI:18404526 | RefSeq | NP_001078019.1 | 290 | aldo-keto reductase family 4 member C8 [Arabidopsis thaliana] |
GI:42571107 | RefSeq | NP_001118465.1 | 291 | aldo-keto reductase family 4 member C8 [Arabidopsis thaliana] |
GI:145330687 | RefSeq | NP_001118465.1 | 291 | aldo-keto reductase family 4 member C8 [Arabidopsis thaliana] |
GI:18404526 | RefSeq | XP_002879707.1 | 311 | aldo/keto reductase family protein [Arabidopsis lyrata subsp. lyrata] |
GI:42571107 | RefSeq | XP_004253291.1 | 311 | PREDICTED: aldo-keto reductase family 4 member C8 isoform X1 [Solanum lycopersicum] |
GI:145330687 | RefSeq | XP_004253291.1 | 311 | PREDICTED: aldo-keto reductase family 4 member C8 isoform X1 [Solanum lycopersicum] |
GI:42571107 | RefSeq | XP_010314927.1 | 291 | PREDICTED: aldo-keto reductase family 4 member C8 isoform X2 [Solanum lycopersicum] |
GI:145330687 | RefSeq | XP_010314927.1 | 291 | PREDICTED: aldo-keto reductase family 4 member C8 isoform X2 [Solanum lycopersicum] |
GI:18404526 | RefSeq | XP_010314928.1 | 290 | PREDICTED: aldo-keto reductase family 4 member C8 isoform X3 [Solanum lycopersicum] |
GI:186506243 | RefSeq | XP_010314928.1 | 290 | PREDICTED: aldo-keto reductase family 4 member C8 isoform X3 [Solanum lycopersicum] |